Lactococcus lactis subsp. lactis Il1403: L102317 Help Entry L102317           CDS       T00045                                  Symbol hslA Name (GenBank) HU like DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism lla  Lactococcus lactis subsp. lactis Il1403 Brite KEGG Orthology (KO) [BR:lla00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:lla03032]     L102317 (hslA)    03036 Chromosome and associated proteins [BR:lla03036]     L102317 (hslA)    03400 DNA repair and recombination proteins [BR:lla03400]     L102317 (hslA) DNA replication proteins [BR:lla03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     L102317 (hslA) Chromosome and associated proteins [BR:lla03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     L102317 (hslA) DNA repair and recombination proteins [BR:lla03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       L102317 (hslA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-DNA_bdg HU-CCDC81_euk_2 HU-CCDC81_bac_2 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  AAK04600 UniProt:  Q9CI64 Structure PDB LinkDB All DBs Position 502338..502613 Genome browser AA seq 91 aa AA seqDB search MANKQDLIAEVAAKTGLTKKDSEKAVNAFGEVVTEFLAKGEKVQLIGFGTFETRERAARE GRNPQTGEAIKIAATVVPAFKAGKALKDAVK NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggctaacaaacaagatcttatcgctgaagttgcagcaaaaacaggattgactaaaaaa gattcagaaaaagcagttaatgcttttggtgaagttgtaactgaattccttgcaaaaggt gaaaaagttcaattgatcggttttggtactttcgaaactcgcgaacgcgcagctcgtgaa ggacgtaacccacaaactggtgaagcaatcaaaatcgctgctacagttgttcctgcattc aaagctggtaaagcattgaaagacgcagttaaataa

DBGET integrated database retrieval system