Lacipirellula limnantheis: I41_18710 Help Entry I41_18710         CDS       T09857                                  Symbol acpP_2 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism llh  Lacipirellula limnantheis Pathway llh01100   Metabolic pathways llh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:llh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     I41_18710 (acpP_2)    00074 Mycolic acid biosynthesis     I41_18710 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     I41_18710 (acpP_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QDT72689 UniProt:  A0A517TWD6 LinkDB All DBs Position 2295133..2295393 Genome browser AA seq 86 aa AA seqDB search MTRDEIKLEVLDILSDIAPDEDLSQLKDEQSFREQMELDSMDFLDIVMELRKRHRIQIPE DDYVNLASMDSTVTYLEPLMKDIQRV NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgacccgcgacgaaatcaaactcgaagtcctcgacattctctccgacatcgcccccgac gaggatctgtcgcagctcaaggacgagcagagctttcgcgagcagatggaactcgacagc atggacttcctcgacatcgtgatggagctccgcaagcgtcaccgcatccagatccccgag gacgactacgtcaacctcgccagcatggactcgacggtgacctacctggagccgttgatg aaggacattcaacgggtgtga

DBGET integrated database retrieval system