Lacipirellula limnantheis: I41_43630 Help Entry I41_43630         CDS       T09857                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism llh  Lacipirellula limnantheis Pathway llh02020   Two-component system llh02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:llh00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     I41_43630  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     I41_43630  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:llh02035]     I41_43630 Bacterial motility proteins [BR:llh02035]  Flagellar system   Flagellar assembly proteins    Others     I41_43630 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  QDT75154 UniProt:  A0A517U3F2 LinkDB All DBs Position complement(5345863..5346132) Genome browser AA seq 89 aa AA seqDB search MQVYGASQLHGPQSLQGPHWNRPTAPATGSQPTDSVEFSAAAEAAMNAIDGGEFRADLVA RVRAQIADGSYDTPDKMAMAFDAMLDELA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgcaggtttacggtgcttcgcaacttcacggaccccaatcgctgcaaggtccgcattgg aaccgcccaacggctccggccactggttcccagccaaccgacagcgtcgaattttcggcc gccgccgaagcggcgatgaacgccatcgacggcggcgagttccgggctgatctagttgca cgggtccgtgcccaaattgccgacgggtcgtatgacacgccggacaagatggcgatggcc ttcgatgcaatgctcgacgagttggcgtag

DBGET integrated database retrieval system