Lutzomyia longipalpis: 129787916 Help Entry 129787916         CDS       T10428                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism lll  Lutzomyia longipalpis Pathway lll04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:lll00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     129787916  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:lll04121]     129787916    03400 DNA repair and recombination proteins [BR:lll03400]     129787916 Ubiquitin system [BR:lll04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      129787916    Cul5 complex      129787916 DNA repair and recombination proteins [BR:lll03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      129787916 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 GABP-alpha Motif Other DBs NCBI-GeneID:  129787916 NCBI-ProteinID:  XP_055679734 LinkDB All DBs Position 1:47473355..47474756 Genome browser AA seq 118 aa AA seqDB search MDVFLMIRRKKTTIFTDAKDNTTVSELKKMIEGILKIRPRDQQLYNKDNTVMEDDKPLQD YGISMVTAKAQAPAQLGLAIRTETGEFEPLEIAPYSSPPDLPDVMKNQEAANGQEQVA NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggatgtatttctcatgattcggcgaaagaaaacaaccattttcacagacgccaaagac aacacgacagttagtgaattgaaaaagatgatagaaggcattctgaagattcgaccccgc gaccaacagctgtacaacaaagataacacagtaatggaagatgataaaccactacaggac tatggtatttcaatggtaacggccaaggcacaggcaccagcacaacttggcctggcaata cggactgaaacgggggagtttgagccattggaaatagcaccctactcatcaccaccagac ctcccggacgtgatgaagaatcaagaggctgccaatggacaggagcaagttgcttaa

DBGET integrated database retrieval system