Lutzomyia longipalpis: 129793270 Help Entry 129793270         CDS       T10428                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism lll  Lutzomyia longipalpis Pathway lll04013   MAPK signaling pathway - fly lll04145   Phagosome lll04148   Efferocytosis lll04310   Wnt signaling pathway lll04620   Toll-like receptor signaling pathway lll05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:lll00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     129793270    04310 Wnt signaling pathway     129793270  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     129793270    04148 Efferocytosis     129793270  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     129793270  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     129793270  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lll04131]     129793270   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lll04147]     129793270    04031 GTP-binding proteins [BR:lll04031]     129793270 Membrane trafficking [BR:lll04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     129793270  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     129793270   Macropinocytosis    Ras GTPases     129793270  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     129793270 Exosome [BR:lll04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129793270   Exosomal proteins of other body fluids (saliva and urine)    129793270   Exosomal proteins of colorectal cancer cells    129793270   Exosomal proteins of bladder cancer cells    129793270 GTP-binding proteins [BR:lll04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     129793270 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  129793270 NCBI-ProteinID:  XP_055689074 UniProt:  A0A240SY11 LinkDB All DBs Position 3:14335600..14337099 Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSTPIILVGTKLDLR DDRQTVEKLRDKKLAPITYPQGLAMAKEIGSVKYLECSALTQKGLKTVFDEAIRAVLCPV LQVKSKRKCVLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggctataaagtgcgttgtggtgggcgatggggccgtggggaagacatgtctcctc atcagttacaccacaaatgccttccctggcgaatatatacccaccgtattcgataattat tcagcaaatgtcatggtggatgggaaacccatcaatctgggattgtgggatacagctggg caggaggactacgatcgtcttcggccactctcatacccccagacagatgtcttcctcatt tgcttttccctcgtcaatccggcatcctttgagaatgtacgcgccaagtggttccctgaa gtgcgtcatcactgcccaagtacacccatcatccttgtgggtacaaagttggacctccgc gatgatcgtcagacagtcgagaagcttcgggacaaaaagttggctcccatcacgtatcca cagggcttagcaatggccaaggagattggctctgtgaagtacttggagtgctccgccctc acccaaaagggcctaaagacggtcttcgacgaagccatccgagccgtcctctgtccagtc ctccaggtcaagtccaagcggaagtgtgtcctcctctaa

DBGET integrated database retrieval system