Lutzomyia longipalpis: 129793989 Help Entry 129793989         CDS       T10428                                  Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism lll  Lutzomyia longipalpis Pathway lll03030   DNA replication lll03082   ATP-dependent chromatin remodeling lll03410   Base excision repair lll03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:lll00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     129793989    03410 Base excision repair     129793989    03420 Nucleotide excision repair     129793989   09126 Chromosome    03082 ATP-dependent chromatin remodeling     129793989  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:lll03032]     129793989    03036 Chromosome and associated proteins [BR:lll03036]     129793989    03400 DNA repair and recombination proteins [BR:lll03400]     129793989 Enzymes [BR:lll01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      129793989 DNA replication proteins [BR:lll03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     129793989 Chromosome and associated proteins [BR:lll03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     129793989 DNA repair and recombination proteins [BR:lll03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       129793989 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone DUF6604 DUF5785 Motif Other DBs NCBI-GeneID:  129793989 NCBI-ProteinID:  XP_055690517 UniProt:  A0A1B0CUP6 LinkDB All DBs Position 3:complement(1187389..1187928) Genome browser AA seq 126 aa AA seqDB search MVDKIEDLSLPGSIVQRIVKEALPDGVNVGKEARSVLGRAASVFVIYLTASATNTAKSHN RKAITGQDILDSLEEMEFEDFLEPLKEFQEAFRKNEQGKKNKKKEATSKQAAEETNEQDE EMIVGE NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atggtggataagattgaagatctcagccttccgggctcaattgtacagcgaattgtcaag gaagccctcccagatggggtaaatgtcggcaaagaagcccggagcgtactcggcagagct gcttccgtctttgtgatctacctaacagcctccgccaccaatacagccaaatctcacaac cggaaagccatcacggggcaggatattctggattcactcgaagagatggaatttgaggat tttctggagccactgaaggaattccaagaggccttccggaagaatgagcagggaaagaag aataagaaaaaggaagcaacatcgaagcaagcagctgaggagacaaatgagcaggatgaa gaaatgattgttggggaataa

DBGET integrated database retrieval system