Legionella longbeachae: LLO_0907 Help Entry LLO_0907          CDS       T01183                                  Symbol rpoZ Name (GenBank) RNA polymerase omega subunit   KO K03060   DNA-directed RNA polymerase subunit omega [EC:2.7.7.6] Organism llo  Legionella longbeachae Pathway llo03020   RNA polymerase Brite KEGG Orthology (KO) [BR:llo00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     LLO_0907 (rpoZ)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:llo03021]     LLO_0907 (rpoZ)    03400 DNA repair and recombination proteins [BR:llo03400]     LLO_0907 (rpoZ) Enzymes [BR:llo01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.6  DNA-directed RNA polymerase      LLO_0907 (rpoZ) Transcription machinery [BR:llo03021]  Prokaryotic type   Bacterial type    RNA polymerase     Core subunits      LLO_0907 (rpoZ) DNA repair and recombination proteins [BR:llo03400]  Prokaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase complex (RNAP)       LLO_0907 (rpoZ) SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-ProteinID:  CBJ11254 Pasteur:  llo0907 UniProt:  D3HQT4 LinkDB All DBs Position 1040244..1040447 Genome browser AA seq 67 aa AA seqDB search MARVTVEDCLEHVANRFELVMVATKRARQIAVRGDQPMVEWENDKPTVVALREIAEGLIT PEILDKE NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggcacgagttacagttgaagattgcttagagcacgttgcaaatcgatttgaactagtt atggtggctaccaaacgtgcgcgacaaattgctgttcgaggcgatcaaccaatggtcgaa tgggaaaacgataagcctactgtagtggctttacgtgaaatcgcagaaggtttaattact cctgaaattttggataaagagtaa

DBGET integrated database retrieval system