Legionella longbeachae: LLO_1484 Help Entry LLO_1484          CDS       T01183                                  Symbol acp Name (GenBank) Acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism llo  Legionella longbeachae Pathway llo00998   Biosynthesis of various antibiotics llo01100   Metabolic pathways llo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:llo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LLO_1484 (acp)    00074 Mycolic acid biosynthesis     LLO_1484 (acp)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LLO_1484 (acp) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH Ribosomal_L50 DUF1896 Motif Other DBs NCBI-ProteinID:  CBJ11851 Pasteur:  llo1484 UniProt:  D3HSG3 LinkDB All DBs Position 1758871..1759119 Genome browser AA seq 82 aa AA seqDB search MSTVEERVRKIVVEQLGVKEEELKNDASFVDDLGADSLDTVELVMALEEEFETEIPDEKA EKITTIQEAIDYIESNLNKEEA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgagtacagttgaagagcgtgttcgcaaaattgttgttgaacaattgggtgttaaagaa gaggaattaaagaatgatgcatcattcgttgatgatttaggtgctgattccttagatact gtggaattggttatggctcttgaagaagaatttgaaacagaaattcctgatgaaaaggct gaaaaaatcaccacaattcaagaagcgattgattatattgaatctaatttaaataaagaa gaagcataa

DBGET integrated database retrieval system