Lineus longissimus (bootlace worm): 135489497 Help Entry 135489497         CDS       T09977                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism llon  Lineus longissimus (bootlace worm) Pathway llon04070   Phosphatidylinositol signaling system Brite KEGG Orthology (KO) [BR:llon00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     135489497  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:llon01009]     135489497   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:llon04131]     135489497    03036 Chromosome and associated proteins [BR:llon03036]     135489497   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:llon04147]     135489497 Protein phosphatases and associated proteins [BR:llon01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      135489497 Membrane trafficking [BR:llon04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     135489497 Chromosome and associated proteins [BR:llon03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      135489497 Exosome [BR:llon04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    135489497 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_5 EF-hand_6 EF-hand_9 AIF-1 EF-hand_11 SPEF2_C DUF5580_M EH SPARC_Ca_bdg EFhand_Ca_insen Motif Other DBs NCBI-GeneID:  135489497 NCBI-ProteinID:  XP_064630950 LinkDB All DBs Position 1:complement(17851369..17853544) Genome browser AA seq 115 aa AA seqDB search MRSLGQNPTEAELQVMVNEVDADGNGTIEFPEFLTMMAKKMTNTDSDHEAGIRESFRTFD TDGNGFITKAEFRHIMTKYSEKMTVEVVDEIIRQADNDGDGKINYEEYVKMMMSK NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgaggtctctcggtcagaatcccacagaagctgagctgcaggtcatggttaacgaagtg gacgctgatggaaacggaaccattgaattcccagaattcctcacaatgatggcaaagaaa atgacaaatactgattccgatcacgaagcgggaatacgggagtcgttccgaacgtttgat acggatggcaatggtttcatcaccaaggcagagtttcgccacatcatgaccaaatacagc gagaaaatgactgttgaggtagtggatgagataatcaggcaagctgacaatgatggagat ggaaagattaattatgaagaatacgtcaagatgatgatgagcaagtaa

DBGET integrated database retrieval system