Lineus longissimus (bootlace worm): 135501917 Help Entry 135501917         CDS       T09977                                  Name (RefSeq) ras-related protein Rac1-like   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism llon  Lineus longissimus (bootlace worm) Pathway llon04145   Phagosome llon04148   Efferocytosis llon04310   Wnt signaling pathway llon04620   Toll-like receptor signaling pathway llon05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:llon00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     135501917  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     135501917    04148 Efferocytosis     135501917  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     135501917  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     135501917  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:llon04131]     135501917   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:llon04147]     135501917    04031 GTP-binding proteins [BR:llon04031]     135501917 Membrane trafficking [BR:llon04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     135501917  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     135501917   Macropinocytosis    Ras GTPases     135501917  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     135501917 Exosome [BR:llon04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    135501917   Exosomal proteins of other body fluids (saliva and urine)    135501917   Exosomal proteins of colorectal cancer cells    135501917   Exosomal proteins of bladder cancer cells    135501917 GTP-binding proteins [BR:llon04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     135501917 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  135501917 NCBI-ProteinID:  XP_064650423 LinkDB All DBs Position 17:515378..519564 Genome browser AA seq 212 aa AA seqDB search MSSENIADDDTSSVAQSGDGKVQVKCVVVGDGTVGKTCLLISYSTDTFKENHIPTVFDNY STNVMFSGVPVNLGLWDTAGQGDYDRLRPLSYPNTDVFLICFSLVSPDSFVNVRENWHPE VRHFSPKGTIPVILVGTKADLRSDREALDYLRKKKQAPITYEQGISLAKRIGAVKYAECS AKTMKGVHNVFEEAIRSVLTPKKQSNGRCVLL NT seq 639 nt NT seq  +upstreamnt  +downstreamnt atgtcgtctgagaacatcgccgatgatgacacctcgtctgtcgcccaatctggtgatggc aaggtccaggtaaagtgcgtggtggtcggcgacggtacggtgggaaagacgtgcctgctg ataagctattccacagatacctttaaggaaaaccatatccccaccgtgtttgataactat agcacaaacgtcatgttcagtggcgtaccagttaaccttggactatgggacacggcgggg caaggcgactatgacagactgcggccgctatcttacccgaataccgatgtttttcttatc tgtttttcgctagtctccccggattcattcgtcaacgtgagggagaactggcacccggaa gtgcgtcatttttctccaaaagggaccattcctgtgattctggtcgggacgaaggcggac ttgaggagtgatagagaggctttggattatcttaggaaaaagaaacaagccccaatcaca tacgaacaaggcatttctttagcgaagaggatcggggcggtgaagtacgccgagtgttct gctaagacaatgaaaggggtacataatgtgtttgaagaagccattaggtccgttctcact ccgaagaagcaatccaacgggcgctgtgttttactttga

DBGET integrated database retrieval system