Litorivicinus lipolyticus: GH975_04330 Help Entry GH975_04330       CDS       T06278                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism llp  Litorivicinus lipolyticus Pathway llp01100   Metabolic pathways llp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:llp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GH975_04330 (acpP)    00074 Mycolic acid biosynthesis     GH975_04330 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GH975_04330 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C HLH Ribosomal_L50 DUF1896 Motif Other DBs NCBI-ProteinID:  QGG79842 UniProt:  A0A5Q2QC40 LinkDB All DBs Position 846081..846314 Genome browser AA seq 77 aa AA seqDB search MSTIEERVKKIVCEQLGVKDEEVNIESSFVQDLGADSLDTVELVMALEEEFETEIPDEKA ETITTVQQAVDYINANS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcactattgaagaacgcgtcaagaaaatcgtttgtgaacagcttggcgtcaaagat gaagaagtcaacatcgagtcatcttttgtgcaggacctgggtgcagactcgctggacacg gttgagctggtaatggctttggaagaggaattcgaaactgaaatccctgacgaaaaagca gaaaccatcactacagttcagcaagcggtcgactacatcaacgccaacagctaa

DBGET integrated database retrieval system