KEGG   Litorivicinus lipolyticus: GH975_08875
Entry
GH975_08875       CDS       T06278                                 
Name
(GenBank) aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
llp  Litorivicinus lipolyticus
Pathway
llp00260  Glycine, serine and threonine metabolism
llp00261  Monobactam biosynthesis
llp00270  Cysteine and methionine metabolism
llp00300  Lysine biosynthesis
llp01100  Metabolic pathways
llp01110  Biosynthesis of secondary metabolites
llp01120  Microbial metabolism in diverse environments
llp01210  2-Oxocarboxylic acid metabolism
llp01230  Biosynthesis of amino acids
Module
llp_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
llp_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:llp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GH975_08875
   00270 Cysteine and methionine metabolism
    GH975_08875
   00300 Lysine biosynthesis
    GH975_08875
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    GH975_08875
Enzymes [BR:llp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     GH975_08875
SSDB
Motif
Pfam: AA_kinase ACT_9 ACT_7 ACT
Other DBs
NCBI-ProteinID: QGG80673
UniProt: A0A5Q2QBK7
LinkDB
Position
complement(1749744..1750964)
AA seq 406 aa
MALIVQKFGGTSVGTVDKIKAIAEKVQKFRSAGHQIVVVVSAMSGETNRLVALADEMQAR
PDAAEYDTIVSTGEQVTMALLSMALKERGCDARSFTGWQLGMHTDHSHAKARIKRIDETP
IRTALDAGQVAVVAGFQGITDDNRISTLGRGGSDTTAVAIAAALKADECQIYTDVDGVYT
TDPRVVDSARRMETITFEEMLELASLGSKVLQIRSVEFAGKYKVPLRVLHAFEDGPGTLI
TVEDHNQMESPVISGIAFNRDEAKVTLLGVPDVPGVAAAILAPVGDANIEVDMVVQNVGE
NNTTDFTFTVHKNDYERAMELLESVRVSLNARELRGDNAICKVSVVGVGMRSHAGVASTM
FKTLASESINIQMISTSEIKISVVIEEKYLELATRALHSAFDLAAV
NT seq 1221 nt   +upstreamnt  +downstreamnt
ttggcacttatagttcagaagtttggcggcacctcggtgggcacggtcgacaagatcaag
gccatcgccgagaaggtccaaaagttccgcagcgccggccaccaaatcgtcgtggtggtc
agtgccatgagcggcgagaccaaccggttggtcgcgttggctgacgaaatgcaggcgcgt
cctgatgccgccgagtacgacactattgtcagtaccggcgagcaggtgacgatggcgctg
ttgagcatggcgctgaaagagcgcggctgtgatgcgcgcagtttcaccggatggcagttg
ggcatgcacaccgaccattcgcatgccaaagcacgcattaagcggattgatgaaaccccg
attcggaccgcgttggacgccggccaagtcgccgtcgtcgccggatttcagggtatcacc
gatgacaatcgcatcagcacactgggcaggggtggttcggacaccacggcggtggcgatt
gcggcggcgttgaaggctgacgaatgccagatctataccgatgttgatggcgtttacact
accgatccgcgcgtggtcgacagcgcgcgccggatggaaaccatcaccttcgaggaaatg
cttgagctggcgtcattgggctcaaaggtgctgcaaattcgtagtgtcgagtttgccggc
aaatacaaagttccgctgcgggtccttcatgcgtttgaagacggccccggcacattgatt
accgtagaggaccacaatcagatggaaagccccgttatttctggaatcgcgtttaaccga
gatgaagccaaggtgaccttgctgggtgtgccggacgtgccgggcgtggccgcggcgatt
ttggcgccggtcggtgatgccaatatcgaagtggacatggtcgtgcaaaacgtcggtgaa
aataacaccacggatttcaccttcaccgtgcacaaaaacgattacgagcgtgccatggag
ttactggaatccgtgcgtgtgtcgttgaatgcccgcgaattgcgtggcgacaacgccatc
tgcaaggtgtcggtggtcggggttggcatgcgctcgcacgcaggtgtcgccagcaccatg
ttcaagaccttggcgagcgagagcatcaacatccagatgatttcgacgtccgagatcaag
atttcggtcgtgatcgaagagaagtacctggagttggcgacgcgcgcattgcacagcgcg
ttcgatttggccgcggtctaa

DBGET integrated database retrieval system