Labilithrix luteola: AKJ09_02480 Help Entry AKJ09_02480       CDS       T04033                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism llu  Labilithrix luteola Pathway llu00998   Biosynthesis of various antibiotics llu01100   Metabolic pathways llu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:llu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AKJ09_02480    00074 Mycolic acid biosynthesis     AKJ09_02480   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AKJ09_02480 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  AKU95816 UniProt:  A0A0K1PR14 LinkDB All DBs Position complement(2466160..2466417) Genome browser AA seq 85 aa AA seqDB search MNTYEQDSRTIALTVLAEIAEVDRSKLRGDDRLREDLGMDSLSSLELLSTIGEKLDLDLM IEDAMDIRTVDDACAFVESQCRARA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaacacgtatgagcaagactcccgcaccatcgctctcacggtcctcgcggagatcgcc gaagtggaccggagcaagcttcgtggtgacgaccgccttcgtgaggatctcgggatggac tcgctctcgagtctcgagctgctctccacgatcggagagaagctggacctcgacctcatg atcgaggacgccatggatatccgcacggttgacgatgcctgcgcattcgtggagagccaa tgtcgagcacgagcgtga

DBGET integrated database retrieval system