Labilithrix luteola: AKJ09_08897 Help Entry AKJ09_08897       CDS       T04033                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism llu  Labilithrix luteola Pathway llu00998   Biosynthesis of various antibiotics llu01100   Metabolic pathways llu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:llu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AKJ09_08897    00074 Mycolic acid biosynthesis     AKJ09_08897   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AKJ09_08897 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  AKV02234 UniProt:  A0A0K1Q930 LinkDB All DBs Position 9354083..9354328 Genome browser AA seq 81 aa AA seqDB search MSNVKEELRALISEISEMDDIPDDVSFKDLGIDSMMGVEIVAAIERKYQVKIADAELAQV TTLNSSLELVQKKLAPQAEVA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgtcgaacgtcaaagaagagctccgcgccctcatctccgaaatctcggaaatggacgac atccccgatgacgtgtccttcaaggacctcggcatcgactccatgatgggcgtcgagatc gtcgcggcgatcgagcgtaagtaccaggtgaagatcgccgacgcggagctcgcgcaggtc accacgctgaacagctcgctcgagttggtgcagaagaagctcgccccgcaggccgaagtc gcctga

DBGET integrated database retrieval system