Labilithrix luteola: AKJ09_10315 Help Entry AKJ09_10315       CDS       T04033                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism llu  Labilithrix luteola Pathway llu00998   Biosynthesis of various antibiotics llu01100   Metabolic pathways llu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:llu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AKJ09_10315    00074 Mycolic acid biosynthesis     AKJ09_10315   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AKJ09_10315 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AKV03652 UniProt:  A0A0K1QDA3 LinkDB All DBs Position 10903899..10904141 Genome browser AA seq 80 aa AA seqDB search MAQDIASEVKRIIKEQLDVEEKDIKAESTFIEDLGADSLGLVELVLAFEDAFEIDIPDED TEKIRTVQDAIDYIEKHAKK NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggcccaagacatcgcgagcgaggtcaagcgcatcatcaaggagcagctcgacgtcgag gagaaggacatcaaggcggaatcgacgttcatcgaggacctcggcgccgactccctcggt cttgtcgagctcgtccttgctttcgaagacgccttcgagatcgacatcccggacgaggac acggaaaagatccgtaccgtccaggacgccatcgactacatcgagaagcacgcgaagaag taa

DBGET integrated database retrieval system