Lutra lutra (Eurasian river otter): 125080203 Help Entry 125080203         CDS       T08100                                  Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism llv  Lutra lutra (Eurasian river otter) Pathway llv04014   Ras signaling pathway llv04015   Rap1 signaling pathway llv04022   cGMP-PKG signaling pathway llv04024   cAMP signaling pathway llv04062   Chemokine signaling pathway llv04071   Sphingolipid signaling pathway llv04072   Phospholipase D signaling pathway llv04081   Hormone signaling llv04144   Endocytosis llv04150   mTOR signaling pathway llv04270   Vascular smooth muscle contraction llv04310   Wnt signaling pathway llv04350   TGF-beta signaling pathway llv04360   Axon guidance llv04510   Focal adhesion llv04517   IgSF CAM signaling llv04520   Adherens junction llv04530   Tight junction llv04611   Platelet activation llv04621   NOD-like receptor signaling pathway llv04625   C-type lectin receptor signaling pathway llv04660   T cell receptor signaling pathway llv04670   Leukocyte transendothelial migration llv04722   Neurotrophin signaling pathway llv04810   Regulation of actin cytoskeleton llv04921   Oxytocin signaling pathway llv04928   Parathyroid hormone synthesis, secretion and action llv04972   Pancreatic secretion llv05100   Bacterial invasion of epithelial cells llv05132   Salmonella infection llv05133   Pertussis llv05135   Yersinia infection llv05152   Tuberculosis llv05163   Human cytomegalovirus infection llv05200   Pathways in cancer llv05203   Viral carcinogenesis llv05205   Proteoglycans in cancer llv05206   MicroRNAs in cancer llv05210   Colorectal cancer llv05417   Lipid and atherosclerosis llv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:llv00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     125080203    04015 Rap1 signaling pathway     125080203    04310 Wnt signaling pathway     125080203    04350 TGF-beta signaling pathway     125080203    04072 Phospholipase D signaling pathway     125080203    04071 Sphingolipid signaling pathway     125080203    04024 cAMP signaling pathway     125080203    04022 cGMP-PKG signaling pathway     125080203    04150 mTOR signaling pathway     125080203   09133 Signaling molecules and interaction    04081 Hormone signaling     125080203    04517 IgSF CAM signaling     125080203  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     125080203   09144 Cellular community - eukaryotes    04510 Focal adhesion     125080203    04520 Adherens junction     125080203    04530 Tight junction     125080203   09142 Cell motility    04810 Regulation of actin cytoskeleton     125080203  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     125080203    04621 NOD-like receptor signaling pathway     125080203    04625 C-type lectin receptor signaling pathway     125080203    04660 T cell receptor signaling pathway     125080203    04670 Leukocyte transendothelial migration     125080203    04062 Chemokine signaling pathway     125080203   09152 Endocrine system    04921 Oxytocin signaling pathway     125080203    04928 Parathyroid hormone synthesis, secretion and action     125080203   09153 Circulatory system    04270 Vascular smooth muscle contraction     125080203   09154 Digestive system    04972 Pancreatic secretion     125080203   09156 Nervous system    04722 Neurotrophin signaling pathway     125080203   09158 Development and regeneration    04360 Axon guidance     125080203  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125080203    05206 MicroRNAs in cancer     125080203    05205 Proteoglycans in cancer     125080203    05203 Viral carcinogenesis     125080203   09162 Cancer: specific types    05210 Colorectal cancer     125080203   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     125080203   09171 Infectious disease: bacterial    05132 Salmonella infection     125080203    05135 Yersinia infection     125080203    05133 Pertussis     125080203    05152 Tuberculosis     125080203    05100 Bacterial invasion of epithelial cells     125080203   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125080203    05418 Fluid shear stress and atherosclerosis     125080203  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:llv04131]     125080203   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:llv04147]     125080203    04031 GTP-binding proteins [BR:llv04031]     125080203 Membrane trafficking [BR:llv04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     125080203 Exosome [BR:llv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125080203   Exosomal proteins of other body fluids (saliva and urine)    125080203   Exosomal proteins of colorectal cancer cells    125080203   Exosomal proteins of bladder cancer cells    125080203 GTP-binding proteins [BR:llv04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     125080203 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  125080203 NCBI-ProteinID:  XP_047550022 LinkDB All DBs Position 1:204711355..204767016 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggcaagacttgt ttgctcatcgtctttagcaaggaccagttcccagaggtgtatgtacccacagtgtttgag aactatgtggcagatatcgaagttgatggaaagcaggtagagttggctttgtgggataca gctgggcaggaagattatgaccgcttgaggcctctctcctatccggacactgatgttata ctgatgtgtttctccattgacagccctgatagtttagaaaatatcccagaaaaatggacc ccggaagtcaagcacttctgtcccaacgtgcccatcatcctggttgggaacaagaaggat cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccggtgaaa cctgaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system