Lutra lutra (Eurasian river otter): 125082311 Help Entry 125082311         CDS       T08100                                  Name (RefSeq) somatostatin   KO K05237   somatostatin Organism llv  Lutra lutra (Eurasian river otter) Pathway llv04024   cAMP signaling pathway llv04080   Neuroactive ligand-receptor interaction llv04081   Hormone signaling llv04935   Growth hormone synthesis, secretion and action llv04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:llv00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     125082311   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     125082311    04081 Hormone signaling     125082311  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     125082311   09154 Digestive system    04971 Gastric acid secretion     125082311  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:llv04052]     125082311 Cytokines and neuropeptides [BR:llv04052]  Neuropeptides   GPCR binding    125082311 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  125082311 NCBI-ProteinID:  XP_047553780 LinkDB All DBs Position 1:complement(111241120..111242590) Genome browser AA seq 116 aa AA seqDB search MLSCRLQCALAALSIVLALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcctgccgcctccagtgcgcgctggccgcgctgtccattgtcctggctctgggc ggtgtcaccggcgcgccctcggatccccgactccgtcagtttctgcagaagtccctggca gctgccgcggggaagcaggaactggccaagtacttcttggcggagctgctgtctgaaccc aaccagacagagaacgatgccctggaacctgaagatttgtcccaggctgctgagcaggat gaaatgaggctggaactgcagagatctgctaactcaaaccctgccatggcaccccgagaa cgcaaagctggctgcaagaatttcttctggaagactttcacatcctgttaa

DBGET integrated database retrieval system