Lutra lutra (Eurasian river otter): 125083501 Help Entry 125083501         CDS       T08100                                  Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism llv  Lutra lutra (Eurasian river otter) Pathway llv04010   MAPK signaling pathway llv04020   Calcium signaling pathway llv04022   cGMP-PKG signaling pathway llv04114   Oocyte meiosis llv04218   Cellular senescence llv04310   Wnt signaling pathway llv04360   Axon guidance llv04370   VEGF signaling pathway llv04380   Osteoclast differentiation llv04625   C-type lectin receptor signaling pathway llv04650   Natural killer cell mediated cytotoxicity llv04658   Th1 and Th2 cell differentiation llv04659   Th17 cell differentiation llv04660   T cell receptor signaling pathway llv04662   B cell receptor signaling pathway llv04720   Long-term potentiation llv04724   Glutamatergic synapse llv04921   Oxytocin signaling pathway llv04922   Glucagon signaling pathway llv04924   Renin secretion llv05010   Alzheimer disease llv05014   Amyotrophic lateral sclerosis llv05020   Prion disease llv05022   Pathways of neurodegeneration - multiple diseases llv05031   Amphetamine addiction llv05152   Tuberculosis llv05163   Human cytomegalovirus infection llv05166   Human T-cell leukemia virus 1 infection llv05167   Kaposi sarcoma-associated herpesvirus infection llv05170   Human immunodeficiency virus 1 infection llv05235   PD-L1 expression and PD-1 checkpoint pathway in cancer llv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:llv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     125083501    04310 Wnt signaling pathway     125083501    04370 VEGF signaling pathway     125083501    04020 Calcium signaling pathway     125083501    04022 cGMP-PKG signaling pathway     125083501  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     125083501    04218 Cellular senescence     125083501  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     125083501    04650 Natural killer cell mediated cytotoxicity     125083501    04660 T cell receptor signaling pathway     125083501    04658 Th1 and Th2 cell differentiation     125083501    04659 Th17 cell differentiation     125083501    04662 B cell receptor signaling pathway     125083501   09152 Endocrine system    04922 Glucagon signaling pathway     125083501    04921 Oxytocin signaling pathway     125083501    04924 Renin secretion     125083501   09156 Nervous system    04724 Glutamatergic synapse     125083501    04720 Long-term potentiation     125083501   09158 Development and regeneration    04360 Axon guidance     125083501    04380 Osteoclast differentiation     125083501  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     125083501   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     125083501    05170 Human immunodeficiency virus 1 infection     125083501    05163 Human cytomegalovirus infection     125083501    05167 Kaposi sarcoma-associated herpesvirus infection     125083501   09171 Infectious disease: bacterial    05152 Tuberculosis     125083501   09164 Neurodegenerative disease    05010 Alzheimer disease     125083501    05014 Amyotrophic lateral sclerosis     125083501    05020 Prion disease     125083501    05022 Pathways of neurodegeneration - multiple diseases     125083501   09165 Substance dependence    05031 Amphetamine addiction     125083501   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125083501  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:llv01009]     125083501 Protein phosphatases and associated proteins [BR:llv01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      125083501 SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_FSTL1 EF_SSP120 EH SPARC_Ca_bdg EF-hand_9 USP32_N RSA-1_C Toprim_3 Motif Other DBs NCBI-GeneID:  125083501 NCBI-ProteinID:  XP_047556134 LinkDB All DBs Position 13:complement(65534350..65535296) Genome browser AA seq 170 aa AA seqDB search MGNEASYPEEICSHFNSDEIKRLSKKFKKLDLDRSGSLSVEEFLSLPELHQNPLVQRVID VFDTDGNGEVDFKEFILGASQFSVRGDEEEKLRFAFSIYDIDKDGYISNGELFQVLKLMV GDNLKDWQLQQLVDKTIIVLDRDGDGKISFEEFSAVVRGLDVHKKLVVIV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaagccagttacccggaggagatatgctcccacttcaactccgatgaaatt aaaagactgagcaagaagtttaagaagctagacttggaccgttcaggctctctgagcgtg gaggagttcttgtccctgcccgagctgcaccagaacccgttggtgcagcgagtgatcgac gtcttcgacaccgatggcaatggagaagtggacttcaaggagttcatcctgggggcctcc cagttcagcgtcaggggggacgaggaggagaagttgaggtttgccttcagcatctatgac attgataaagacggctacatttccaacggggaactcttccaggtgctgaagctgatggtg ggcgacaacctgaaggactggcagttacagcagctagtggacaaaaccatcatcgtcctg gatcgggatggagacgggaaaatatcttttgaggagttcagcgctgtggtcagaggcctg gatgtccacaagaagttggtggtgattgtgtga

DBGET integrated database retrieval system