Lutra lutra (Eurasian river otter): 125083570 Help Entry 125083570         CDS       T08100                                  Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism llv  Lutra lutra (Eurasian river otter) Pathway llv04621   NOD-like receptor signaling pathway llv05012   Parkinson disease llv05132   Salmonella infection llv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:llv00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     125083570  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125083570   09164 Neurodegenerative disease    05012 Parkinson disease     125083570   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     125083570  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:llv03110]     125083570 Chaperones and folding catalysts [BR:llv03110]  Protein folding catalysts   Protein disulfide isomerase    125083570 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 Thioredoxin_2 OST3_OST6 AhpC-TSA Thioredoxin_7 Glutaredoxin Thioredoxin_9 Redoxin Motif Other DBs NCBI-GeneID:  125083570 NCBI-ProteinID:  XP_047556284 LinkDB All DBs Position 13:complement(72899210..72912942) Genome browser AA seq 105 aa AA seqDB search MVKQIESKFAFQEALDGAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVD DCQDVASECEVKCMPTFQFFKKGQKVSEFSGANKEKLEATINELI NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagatcgagagcaagtttgcttttcaggaagccttggacggtgcaggggat aaacttgtagtagttgacttctcagccacgtggtgtgggccttgcaaaatgatcaagcct ttctttcattctctctctgagaagtactccaatgtggtgttccttgaagtagatgtggat gactgtcaggatgtcgcttcagagtgtgaagtcaaatgcatgccgaccttccagtttttt aaaaagggacagaaggtgagtgaattttctggagctaataaggaaaaacttgaagccacc ataaatgaattaatctaa

DBGET integrated database retrieval system