Lutra lutra (Eurasian river otter): 125084018 Help Entry 125084018         CDS       T08100                                  Name (RefSeq) interferon alpha-1/2-like   KO K05414   interferon alpha Organism llv  Lutra lutra (Eurasian river otter) Pathway llv04060   Cytokine-cytokine receptor interaction llv04151   PI3K-Akt signaling pathway llv04217   Necroptosis llv04620   Toll-like receptor signaling pathway llv04621   NOD-like receptor signaling pathway llv04622   RIG-I-like receptor signaling pathway llv04623   Cytosolic DNA-sensing pathway llv04630   JAK-STAT signaling pathway llv04650   Natural killer cell mediated cytotoxicity llv04936   Alcoholic liver disease llv05152   Tuberculosis llv05160   Hepatitis C llv05161   Hepatitis B llv05162   Measles llv05163   Human cytomegalovirus infection llv05164   Influenza A llv05165   Human papillomavirus infection llv05167   Kaposi sarcoma-associated herpesvirus infection llv05168   Herpes simplex virus 1 infection llv05169   Epstein-Barr virus infection llv05170   Human immunodeficiency virus 1 infection llv05171   Coronavirus disease - COVID-19 llv05200   Pathways in cancer llv05320   Autoimmune thyroid disease llv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:llv00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     125084018    04151 PI3K-Akt signaling pathway     125084018   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125084018  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     125084018  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     125084018    04621 NOD-like receptor signaling pathway     125084018    04622 RIG-I-like receptor signaling pathway     125084018    04623 Cytosolic DNA-sensing pathway     125084018    04650 Natural killer cell mediated cytotoxicity     125084018  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125084018   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     125084018    05161 Hepatitis B     125084018    05160 Hepatitis C     125084018    05171 Coronavirus disease - COVID-19     125084018    05164 Influenza A     125084018    05162 Measles     125084018    05168 Herpes simplex virus 1 infection     125084018    05163 Human cytomegalovirus infection     125084018    05167 Kaposi sarcoma-associated herpesvirus infection     125084018    05169 Epstein-Barr virus infection     125084018    05165 Human papillomavirus infection     125084018   09171 Infectious disease: bacterial    05152 Tuberculosis     125084018   09163 Immune disease    05320 Autoimmune thyroid disease     125084018   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125084018   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     125084018  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:llv04052]     125084018 Cytokines and neuropeptides [BR:llv04052]  Cytokines   Interferons    125084018 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  125084018 NCBI-ProteinID:  XP_047557051 LinkDB All DBs Position 13:complement(47199152..47199843) Genome browser AA seq 198 aa AA seqDB search MALPCSFLVALVVLSCHTLGSLGCDLPQDHGLLNWRALMLLRQMRRVSPFSCLRDRNDFA FPQEVFDSKQLQKAQALSVIHVTNQKTFHLVCTEASPAPWNTTLLEELCSGLSEQLGHLE DCPLQEAGVGETPLVNGDSILRNYFQRISLYLQEKQYSPCAWEMVRAEIMKAFSSSTTLQ ERLRGKKRDLVQHGDDSH NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atggccctgccgtgctccttcttggtggccctggtggtgctcagctgccacaccctcggc tctctgggatgtgacctgcctcaggaccatggtctgctgaactggagggccttgatgctc ctgcgacaaatgaggagagtctcccctttttcctgcctgagggacagaaatgactttgcc ttcccccaagaggtgtttgacagcaagcagctgcagaaggctcaagccctctctgtcatc catgtgacgaaccagaagaccttccacctcgtctgcacagaggcctcacctgctccctgg aacacgaccctcctggaggaattgtgctcgggactttctgagcagctgggccacctggaa gattgtcccctgcaggaggcgggggtgggagagacgcccctggtgaatggggactccatc ctgaggaactacttccaaagaatctccctctatctgcaagagaagcaatacagcccttgt gcctgggagatggtccgagcagagatcatgaaagctttctcttcatcaacaaccttgcaa gaaaggttaaggggcaagaaacgagacctggttcaacatggtgatgactctcactga

DBGET integrated database retrieval system