Lutra lutra (Eurasian river otter): 125087970 Help Entry 125087970         CDS       T08100                                  Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism llv  Lutra lutra (Eurasian river otter) Pathway llv04060   Cytokine-cytokine receptor interaction llv04061   Viral protein interaction with cytokine and cytokine receptor llv04062   Chemokine signaling pathway llv04620   Toll-like receptor signaling pathway llv04621   NOD-like receptor signaling pathway llv04623   Cytosolic DNA-sensing pathway llv04668   TNF signaling pathway llv05020   Prion disease llv05142   Chagas disease llv05163   Human cytomegalovirus infection llv05164   Influenza A llv05168   Herpes simplex virus 1 infection llv05323   Rheumatoid arthritis llv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:llv00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     125087970   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125087970    04061 Viral protein interaction with cytokine and cytokine receptor     125087970  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     125087970    04621 NOD-like receptor signaling pathway     125087970    04623 Cytosolic DNA-sensing pathway     125087970    04062 Chemokine signaling pathway     125087970  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     125087970    05168 Herpes simplex virus 1 infection     125087970    05163 Human cytomegalovirus infection     125087970   09174 Infectious disease: parasitic    05142 Chagas disease     125087970   09163 Immune disease    05323 Rheumatoid arthritis     125087970   09164 Neurodegenerative disease    05020 Prion disease     125087970   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125087970  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:llv04052]     125087970    00536 Glycosaminoglycan binding proteins [BR:llv00536]     125087970 Cytokines and neuropeptides [BR:llv04052]  Cytokines   Chemokines    125087970 Glycosaminoglycan binding proteins [BR:llv00536]  Heparan sulfate / Heparin   Chemokines    125087970 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Ig_NUP210_1st CXCL16 Motif Other DBs NCBI-GeneID:  125087970 NCBI-ProteinID:  XP_047564791 LinkDB All DBs Position 16:37703462..37709898 Genome browser AA seq 91 aa AA seqDB search MKVSAATFAVLLATAAFCAPASASPYASDTTPCCFAYISRRLPFTHIQEYFYTSSKCSMP AVVFVTRKQRQVCANPQKKWVRDHINSLEMS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgcagctacctttgcagtcctccttgccactgccgccttctgcgctcct gcctctgcctccccatatgcctcggacaccaccccctgctgctttgcctacatctcccgc cgactgcccttcacccacatccaggagtatttctacaccagcagcaagtgctccatgcca gcggtcgtctttgtcacccggaagcaacgccaagtgtgtgccaacccacagaagaaatgg gtgcgggaccacatcaactctttggagatgagttag

DBGET integrated database retrieval system