KEGG   Lutra lutra (Eurasian river otter): 125090900
Entry
125090900         CDS       T08100                                 
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
llv  Lutra lutra (Eurasian river otter)
Pathway
llv04010  MAPK signaling pathway
llv04014  Ras signaling pathway
llv04015  Rap1 signaling pathway
llv04024  cAMP signaling pathway
llv04062  Chemokine signaling pathway
llv04071  Sphingolipid signaling pathway
llv04145  Phagosome
llv04148  Efferocytosis
llv04151  PI3K-Akt signaling pathway
llv04310  Wnt signaling pathway
llv04360  Axon guidance
llv04370  VEGF signaling pathway
llv04380  Osteoclast differentiation
llv04510  Focal adhesion
llv04517  IgSF CAM signaling
llv04518  Integrin signaling
llv04520  Adherens junction
llv04530  Tight junction
llv04613  Neutrophil extracellular trap formation
llv04620  Toll-like receptor signaling pathway
llv04650  Natural killer cell mediated cytotoxicity
llv04662  B cell receptor signaling pathway
llv04664  Fc epsilon RI signaling pathway
llv04666  Fc gamma R-mediated phagocytosis
llv04670  Leukocyte transendothelial migration
llv04722  Neurotrophin signaling pathway
llv04810  Regulation of actin cytoskeleton
llv04932  Non-alcoholic fatty liver disease
llv04933  AGE-RAGE signaling pathway in diabetic complications
llv04972  Pancreatic secretion
llv05014  Amyotrophic lateral sclerosis
llv05020  Prion disease
llv05022  Pathways of neurodegeneration - multiple diseases
llv05100  Bacterial invasion of epithelial cells
llv05132  Salmonella infection
llv05135  Yersinia infection
llv05163  Human cytomegalovirus infection
llv05167  Kaposi sarcoma-associated herpesvirus infection
llv05169  Epstein-Barr virus infection
llv05170  Human immunodeficiency virus 1 infection
llv05200  Pathways in cancer
llv05203  Viral carcinogenesis
llv05205  Proteoglycans in cancer
llv05208  Chemical carcinogenesis - reactive oxygen species
llv05210  Colorectal cancer
llv05211  Renal cell carcinoma
llv05212  Pancreatic cancer
llv05231  Choline metabolism in cancer
llv05415  Diabetic cardiomyopathy
llv05416  Viral myocarditis
llv05417  Lipid and atherosclerosis
llv05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:llv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    125090900
   04014 Ras signaling pathway
    125090900
   04015 Rap1 signaling pathway
    125090900
   04310 Wnt signaling pathway
    125090900
   04370 VEGF signaling pathway
    125090900
   04071 Sphingolipid signaling pathway
    125090900
   04024 cAMP signaling pathway
    125090900
   04151 PI3K-Akt signaling pathway
    125090900
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    125090900
   04518 Integrin signaling
    125090900
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    125090900
   04148 Efferocytosis
    125090900
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    125090900
   04520 Adherens junction
    125090900
   04530 Tight junction
    125090900
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    125090900
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    125090900
   04620 Toll-like receptor signaling pathway
    125090900
   04650 Natural killer cell mediated cytotoxicity
    125090900
   04662 B cell receptor signaling pathway
    125090900
   04664 Fc epsilon RI signaling pathway
    125090900
   04666 Fc gamma R-mediated phagocytosis
    125090900
   04670 Leukocyte transendothelial migration
    125090900
   04062 Chemokine signaling pathway
    125090900
  09154 Digestive system
   04972 Pancreatic secretion
    125090900
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    125090900
  09158 Development and regeneration
   04360 Axon guidance
    125090900
   04380 Osteoclast differentiation
    125090900
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    125090900
   05205 Proteoglycans in cancer
    125090900
   05208 Chemical carcinogenesis - reactive oxygen species
    125090900
   05203 Viral carcinogenesis
    125090900
   05231 Choline metabolism in cancer
    125090900
  09162 Cancer: specific types
   05210 Colorectal cancer
    125090900
   05212 Pancreatic cancer
    125090900
   05211 Renal cell carcinoma
    125090900
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    125090900
   05163 Human cytomegalovirus infection
    125090900
   05167 Kaposi sarcoma-associated herpesvirus infection
    125090900
   05169 Epstein-Barr virus infection
    125090900
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    125090900
   05135 Yersinia infection
    125090900
   05100 Bacterial invasion of epithelial cells
    125090900
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    125090900
   05020 Prion disease
    125090900
   05022 Pathways of neurodegeneration - multiple diseases
    125090900
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    125090900
   05418 Fluid shear stress and atherosclerosis
    125090900
   05415 Diabetic cardiomyopathy
    125090900
   05416 Viral myocarditis
    125090900
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    125090900
   04933 AGE-RAGE signaling pathway in diabetic complications
    125090900
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:llv04131]
    125090900
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:llv04147]
    125090900
   04031 GTP-binding proteins [BR:llv04031]
    125090900
Membrane trafficking [BR:llv04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    125090900
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    125090900
  Macropinocytosis
   Ras GTPases
    125090900
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    125090900
Exosome [BR:llv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   125090900
  Exosomal proteins of other body fluids (saliva and urine)
   125090900
  Exosomal proteins of colorectal cancer cells
   125090900
  Exosomal proteins of bladder cancer cells
   125090900
GTP-binding proteins [BR:llv04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    125090900
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU CagD
Other DBs
NCBI-GeneID: 125090900
NCBI-ProteinID: XP_047570077
LinkDB
Position
18:35721227..35744898
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgttggtaaaacttgcctactg
atcagttacacaaccaatgcatttcctggagaatacatccccactgtctttgacaactac
tctgcgaatgttatggtagatggaaaaccggtgaacttgggcttatgggatacagctgga
caagaagattatgaccgattacgtcccttatcctatccgcaaacagatgtattcttaatt
tgcttttctcttgtgagtcctgcatcatttgaaaatgttcgagcaaagtggtaccccgaa
gtgcgacaccactgtcccaacacccccatcatcttggtggggactaaacttgatctcagg
gacgacaaagacacgatcgagaagctgaaggaaaagaagctgactcctatcacctacccg
cagggtctggccatggctaaggagatcggtgcggtaaaatacctggagtgctcagcgctc
acgcagcgaggcctcaagacagtgtttgacgaagcgatccgagcggttctctgcccgcct
cccgtcaagaagaggaagagaaaatgcctgctgttgtaa

DBGET integrated database retrieval system