Lutra lutra (Eurasian river otter): 125093350 Help Entry 125093350         CDS       T08100                                  Name (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism llv  Lutra lutra (Eurasian river otter) Pathway llv04060   Cytokine-cytokine receptor interaction llv04061   Viral protein interaction with cytokine and cytokine receptor llv04151   PI3K-Akt signaling pathway llv04625   C-type lectin receptor signaling pathway llv04630   JAK-STAT signaling pathway llv04658   Th1 and Th2 cell differentiation llv04659   Th17 cell differentiation llv04660   T cell receptor signaling pathway llv04672   Intestinal immune network for IgA production llv04940   Type I diabetes mellitus llv05135   Yersinia infection llv05142   Chagas disease llv05162   Measles llv05166   Human T-cell leukemia virus 1 infection llv05171   Coronavirus disease - COVID-19 llv05200   Pathways in cancer llv05320   Autoimmune thyroid disease llv05321   Inflammatory bowel disease llv05330   Allograft rejection llv05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:llv00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     125093350    04151 PI3K-Akt signaling pathway     125093350   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125093350    04061 Viral protein interaction with cytokine and cytokine receptor     125093350  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     125093350    04660 T cell receptor signaling pathway     125093350    04658 Th1 and Th2 cell differentiation     125093350    04659 Th17 cell differentiation     125093350    04672 Intestinal immune network for IgA production     125093350  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125093350   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     125093350    05171 Coronavirus disease - COVID-19     125093350    05162 Measles     125093350   09171 Infectious disease: bacterial    05135 Yersinia infection     125093350   09174 Infectious disease: parasitic    05142 Chagas disease     125093350   09163 Immune disease    05320 Autoimmune thyroid disease     125093350    05321 Inflammatory bowel disease     125093350    05330 Allograft rejection     125093350    05332 Graft-versus-host disease     125093350   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     125093350  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:llv04052]     125093350    00536 Glycosaminoglycan binding proteins [BR:llv00536]     125093350 Cytokines and neuropeptides [BR:llv04052]  Cytokines   Interleukins    125093350 Glycosaminoglycan binding proteins [BR:llv00536]  Heparan sulfate / Heparin   Cytokines    125093350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL2 Motif Other DBs NCBI-GeneID:  125093350 NCBI-ProteinID:  XP_047574324 LinkDB All DBs Position 2:complement(121291025..121296349) Genome browser AA seq 155 aa AA seqDB search MYKMQLLSCIVLTLALVANSAPTTSSSTKEAQQQLEQLLLDLQLLLNGVNNYESLKLPRM LTFKFYMPKKATELTHLQCLAEELKLLEEVLYLAQSKNFHLTDIKELMSNINVTLLKLKG SETSFKCEYDDETVTITEFLNKWITFCQSIFSTLT NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtacaaaatgcaactcttgtcttgcatcgtactgactctcgcactcgtcgcaaacagt gcacctactacttcaagctctacgaaggaagcacagcaacagctggagcaattgctgctg gacttacagttgctcttgaatggagttaataattatgagagcctcaaactccccaggatg ctcacatttaaattctacatgcccaagaaggccacagaattgactcatcttcaatgtcta gcagaagaactcaaacttttggaggaagtgctatatttagctcaaagcaaaaactttcac ttgacagacatcaaggaactaatgagcaatatcaatgtaacacttctgaaactaaaggga tctgaaacaagtttcaaatgtgaatatgatgacgagacagtaaccattacagaatttctg aacaaatggattactttttgtcaaagcatcttctcaacactgacttga

DBGET integrated database retrieval system