Lutra lutra (Eurasian river otter): 125094403 Help Entry 125094403         CDS       T08100                                  Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism llv  Lutra lutra (Eurasian river otter) Pathway llv04060   Cytokine-cytokine receptor interaction llv04061   Viral protein interaction with cytokine and cytokine receptor llv04062   Chemokine signaling pathway llv04064   NF-kappa B signaling pathway llv04072   Phospholipase D signaling pathway llv04218   Cellular senescence llv04620   Toll-like receptor signaling pathway llv04621   NOD-like receptor signaling pathway llv04622   RIG-I-like receptor signaling pathway llv04657   IL-17 signaling pathway llv04932   Non-alcoholic fatty liver disease llv04933   AGE-RAGE signaling pathway in diabetic complications llv04936   Alcoholic liver disease llv05132   Salmonella infection llv05133   Pertussis llv05134   Legionellosis llv05135   Yersinia infection llv05142   Chagas disease llv05144   Malaria llv05146   Amoebiasis llv05161   Hepatitis B llv05163   Human cytomegalovirus infection llv05164   Influenza A llv05167   Kaposi sarcoma-associated herpesvirus infection llv05171   Coronavirus disease - COVID-19 llv05200   Pathways in cancer llv05202   Transcriptional misregulation in cancer llv05219   Bladder cancer llv05323   Rheumatoid arthritis llv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:llv00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     125094403    04072 Phospholipase D signaling pathway     125094403   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125094403    04061 Viral protein interaction with cytokine and cytokine receptor     125094403  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     125094403  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     125094403    04621 NOD-like receptor signaling pathway     125094403    04622 RIG-I-like receptor signaling pathway     125094403    04657 IL-17 signaling pathway     125094403    04062 Chemokine signaling pathway     125094403  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125094403    05202 Transcriptional misregulation in cancer     125094403   09162 Cancer: specific types    05219 Bladder cancer     125094403   09172 Infectious disease: viral    05161 Hepatitis B     125094403    05171 Coronavirus disease - COVID-19     125094403    05164 Influenza A     125094403    05163 Human cytomegalovirus infection     125094403    05167 Kaposi sarcoma-associated herpesvirus infection     125094403   09171 Infectious disease: bacterial    05132 Salmonella infection     125094403    05135 Yersinia infection     125094403    05133 Pertussis     125094403    05134 Legionellosis     125094403   09174 Infectious disease: parasitic    05146 Amoebiasis     125094403    05144 Malaria     125094403    05142 Chagas disease     125094403   09163 Immune disease    05323 Rheumatoid arthritis     125094403   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125094403   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     125094403    04932 Non-alcoholic fatty liver disease     125094403    04933 AGE-RAGE signaling pathway in diabetic complications     125094403  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:llv04052]     125094403    00536 Glycosaminoglycan binding proteins [BR:llv00536]     125094403 Cytokines and neuropeptides [BR:llv04052]  Cytokines   Chemokines    125094403 Glycosaminoglycan binding proteins [BR:llv00536]  Heparan sulfate / Heparin   Chemokines    125094403 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  125094403 NCBI-ProteinID:  XP_047575944 LinkDB All DBs Position 2:201856111..201859270 Genome browser AA seq 101 aa AA seqDB search MTSKLAVALLAVFLLSAVLCQDAVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPH CENSEIIVKLVNGKEVCLDPKESWVQRIVQIFLKRAEKQES NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgacttccaagctggctgttgctctcttggcagttttccttctttctgcggttctgtgt caagatgcagttctgtcaagagtgagttcagaactccgatgccaatgcattaaaacccac tccacgcctttccatcccaaatatatcaaagaactgagagtgattgacagtggcccacat tgtgaaaactcagaaatcattgtaaagcttgtcaatggaaaagaggtgtgcctggacccc aaggaaagctgggtacagagaattgtgcagatatttttgaagagggctgagaaacaggaa tcatga

DBGET integrated database retrieval system