Lutra lutra (Eurasian river otter): 125096434 Help Entry 125096434         CDS       T08100                                  Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism llv  Lutra lutra (Eurasian river otter) Pathway llv04022   cGMP-PKG signaling pathway llv04081   Hormone signaling llv04270   Vascular smooth muscle contraction llv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:llv00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     125096434   09133 Signaling molecules and interaction    04081 Hormone signaling     125096434  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     125096434  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     125096434  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:llv04052]     125096434 Cytokines and neuropeptides [BR:llv04052]  Neuropeptides   Unclassified    125096434 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  125096434 NCBI-ProteinID:  XP_047579391 LinkDB All DBs Position 3:complement(40191802..40196445) Genome browser AA seq 126 aa AA seqDB search MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPGEELAEPQAAGGSQKKGDKTPGGG GANLKGDRSRLLRDLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccagctgctggcctgcgccctgctgctcacgctactctcgctccggccc tccgaagccaagcccggggcgccgccgaaggtcccgcgaactccgccgggggaggagctg gccgagccccaggctgcgggcggcagtcagaagaagggcgacaaaactcccgggggcggc ggcgccaacctcaaaggcgaccggtcgcgactgctccgcgacctgcgcgtggacaccaag tcgcgggcggcgtgggcccgccttctgcatgagcaccccaacgcgcgcaaatacaaagga ggcaacaagaagggcttgtccaagggctgcttcggcctcaagctggaccggatcggctcc atgagcggcttgggatgttag

DBGET integrated database retrieval system