Lutra lutra (Eurasian river otter): 125097597 Help Entry 125097597         CDS       T08100                                  Name (RefSeq) histone H2A type 2-A   KO K11251   histone H2A Organism llv  Lutra lutra (Eurasian river otter) Pathway llv03082   ATP-dependent chromatin remodeling llv04217   Necroptosis llv04613   Neutrophil extracellular trap formation llv05034   Alcoholism llv05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:llv00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     125097597  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     125097597  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     125097597  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     125097597   09165 Substance dependence    05034 Alcoholism     125097597  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:llv03036]     125097597   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:llv04147]     125097597 Chromosome and associated proteins [BR:llv03036]  Eukaryotic type   Nucleosome assembly factors    Histones     125097597 Exosome [BR:llv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125097597 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  125097597 NCBI-ProteinID:  XP_047581342 LinkDB All DBs Position 4:complement(91422298..91422867) Genome browser AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHHKAKGK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtctggccgtggcaagcaaggaggcaaggcccgcgccaaggccaagtcgcggtcgtct cgcgccggcctgcagttcccagtgggccgagtgcaccggctgctgcgcaagggcaactac gccgagcgggtgggggccggcgcgccggtgtacatggcggcggtgctggagtacctgacg gcggagatcctggagctggcggggaacgcggcccgagacaacaagaagacgcgcatcatc ccgcgccacctccagctggccatccgcaacgacgaggagctcaacaagctgttgggcaaa gtcaccatcgcccagggcggcgtcctgcccaacatccaggccgtgttgctccccaagaag acggagagccaccacaaggcaaagggcaagtga

DBGET integrated database retrieval system