Lutra lutra (Eurasian river otter): 125097600 Help Entry 125097600         CDS       T08100                                  Name (RefSeq) histone H2B type 2-E   KO K11252   histone H2B Organism llv  Lutra lutra (Eurasian river otter) Pathway llv04613   Neutrophil extracellular trap formation llv05034   Alcoholism llv05203   Viral carcinogenesis llv05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:llv00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     125097600  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     125097600   09163 Immune disease    05322 Systemic lupus erythematosus     125097600   09165 Substance dependence    05034 Alcoholism     125097600  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:llv03036]     125097600   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:llv04147]     125097600 Chromosome and associated proteins [BR:llv03036]  Eukaryotic type   Nucleosome assembly factors    Histones     125097600 Exosome [BR:llv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125097600 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  125097600 NCBI-ProteinID:  XP_047581346 LinkDB All DBs Position 4:91422998..91424043 Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccggagccggctaaatccgctcccgcgcccaagaagggctccaagaaagcggtcacc aaagcccagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagttactccatc tacgtgtacaaggtgctcaagcaggtgcacccggacaccggcatctcctccaaggccatg ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgccggcgaggcctcccgc ctggcgcattacaacaagcgctccaccatcacgtcgcgggagatccagacggccgtgcgc ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggcggtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system