Lutra lutra (Eurasian river otter): 125097912 Help Entry 125097912         CDS       T08100                                  Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism llv  Lutra lutra (Eurasian river otter) Pathway llv04382   Cornified envelope formation llv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:llv00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     125097912  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125097912  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:llv04147]     125097912 Exosome [BR:llv04147]  Exosomal proteins   Exosomal proteins of microglial cells    125097912 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 EF-hand_6 TMP_3 Motif Other DBs NCBI-GeneID:  125097912 NCBI-ProteinID:  XP_047582071 LinkDB All DBs Position 4:89476405..89487213 Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcaaatggaacatgccatggaaaccatgatgttcacgtttcacaagtttgct ggtgataaaggctacttaacaaaggaggacctgcgagtactcatggaaaaggagttccct ggatttttggaaaatcagaaagaccctctggccgtggacaaaataatgaaggacctcgac cagtgccgagatggcaaagtgggcttccagagcttcttctcgctaatcgcagggctcacc attgcatgcaatgactattttgtagtacacatgaagcagaagggaaagaaatag

DBGET integrated database retrieval system