Lutra lutra (Eurasian river otter): 125098159 Help Entry 125098159         CDS       T08100                                  Name (RefSeq) transcription factor Jun   KO K04448   transcription factor AP-1 Organism llv  Lutra lutra (Eurasian river otter) Pathway llv01522   Endocrine resistance llv04010   MAPK signaling pathway llv04012   ErbB signaling pathway llv04024   cAMP signaling pathway llv04137   Mitophagy - animal llv04210   Apoptosis llv04310   Wnt signaling pathway llv04380   Osteoclast differentiation llv04510   Focal adhesion llv04530   Tight junction llv04620   Toll-like receptor signaling pathway llv04621   NOD-like receptor signaling pathway llv04625   C-type lectin receptor signaling pathway llv04657   IL-17 signaling pathway llv04658   Th1 and Th2 cell differentiation llv04659   Th17 cell differentiation llv04660   T cell receptor signaling pathway llv04662   B cell receptor signaling pathway llv04668   TNF signaling pathway llv04722   Neurotrophin signaling pathway llv04912   GnRH signaling pathway llv04915   Estrogen signaling pathway llv04921   Oxytocin signaling pathway llv04926   Relaxin signaling pathway llv04932   Non-alcoholic fatty liver disease llv04933   AGE-RAGE signaling pathway in diabetic complications llv05030   Cocaine addiction llv05031   Amphetamine addiction llv05132   Salmonella infection llv05133   Pertussis llv05135   Yersinia infection llv05140   Leishmaniasis llv05142   Chagas disease llv05161   Hepatitis B llv05162   Measles llv05166   Human T-cell leukemia virus 1 infection llv05167   Kaposi sarcoma-associated herpesvirus infection llv05169   Epstein-Barr virus infection llv05170   Human immunodeficiency virus 1 infection llv05171   Coronavirus disease - COVID-19 llv05200   Pathways in cancer llv05203   Viral carcinogenesis llv05207   Chemical carcinogenesis - receptor activation llv05208   Chemical carcinogenesis - reactive oxygen species llv05210   Colorectal cancer llv05211   Renal cell carcinoma llv05224   Breast cancer llv05231   Choline metabolism in cancer llv05235   PD-L1 expression and PD-1 checkpoint pathway in cancer llv05321   Inflammatory bowel disease llv05323   Rheumatoid arthritis llv05417   Lipid and atherosclerosis llv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:llv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     125098159    04012 ErbB signaling pathway     125098159    04310 Wnt signaling pathway     125098159    04668 TNF signaling pathway     125098159    04024 cAMP signaling pathway     125098159  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     125098159   09143 Cell growth and death    04210 Apoptosis     125098159   09144 Cellular community - eukaryotes    04510 Focal adhesion     125098159    04530 Tight junction     125098159  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     125098159    04621 NOD-like receptor signaling pathway     125098159    04625 C-type lectin receptor signaling pathway     125098159    04660 T cell receptor signaling pathway     125098159    04658 Th1 and Th2 cell differentiation     125098159    04659 Th17 cell differentiation     125098159    04657 IL-17 signaling pathway     125098159    04662 B cell receptor signaling pathway     125098159   09152 Endocrine system    04912 GnRH signaling pathway     125098159    04915 Estrogen signaling pathway     125098159    04921 Oxytocin signaling pathway     125098159    04926 Relaxin signaling pathway     125098159   09156 Nervous system    04722 Neurotrophin signaling pathway     125098159   09158 Development and regeneration    04380 Osteoclast differentiation     125098159  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125098159    05207 Chemical carcinogenesis - receptor activation     125098159    05208 Chemical carcinogenesis - reactive oxygen species     125098159    05203 Viral carcinogenesis     125098159    05231 Choline metabolism in cancer     125098159    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     125098159   09162 Cancer: specific types    05210 Colorectal cancer     125098159    05211 Renal cell carcinoma     125098159    05224 Breast cancer     125098159   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     125098159    05170 Human immunodeficiency virus 1 infection     125098159    05161 Hepatitis B     125098159    05171 Coronavirus disease - COVID-19     125098159    05162 Measles     125098159    05167 Kaposi sarcoma-associated herpesvirus infection     125098159    05169 Epstein-Barr virus infection     125098159   09171 Infectious disease: bacterial    05132 Salmonella infection     125098159    05135 Yersinia infection     125098159    05133 Pertussis     125098159   09174 Infectious disease: parasitic    05140 Leishmaniasis     125098159    05142 Chagas disease     125098159   09163 Immune disease    05323 Rheumatoid arthritis     125098159    05321 Inflammatory bowel disease     125098159   09165 Substance dependence    05030 Cocaine addiction     125098159    05031 Amphetamine addiction     125098159   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125098159    05418 Fluid shear stress and atherosclerosis     125098159   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     125098159    04933 AGE-RAGE signaling pathway in diabetic complications     125098159   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     125098159  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:llv03000]     125098159 Transcription factors [BR:llv03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     125098159 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha DUF3450 FlaC_arch TFIIA Motif Other DBs NCBI-GeneID:  125098159 NCBI-ProteinID:  XP_047582613 LinkDB All DBs Position 4:149814030..149815801 Genome browser AA seq 334 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGMVAPAVASAAGGSGSGGFSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLAFPAQPQQQQQPPQPPHHLPQQLPVQHPRLQALKEEPQTVPEMPG ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctgaacgcctcgttcctccag tccgagagcggcgcctacggctacagtaaccccaagatcctgaaacagagcatgaccctg aacctggcagacccggtgggcagcctgaaaccgcacctccgggccaagaactcggacctc ctcacctcgcccgacgtggggctgctcaagctggcctcgcccgagctggagcgcctgata atccagtccagcaacgggcacatcaccaccacaccgacccccacgcagttcctgtgcccc aagaacgtgacagacgagcaggagggcttcgccgagggtttcgtgcgcgccctggccgaa ctgcacagccagaacacgctgcccagcgtcacgtcggcggctcagccggtcagcggggcg ggcatggtggctccggcggtggcttcggcggcgggtggcagcggcagcggcggcttcagt gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaacccgggcgcg ctgagcagcggcggcggggcgccctcctacggcgcggccggcctggccttccccgctcag ccccagcagcagcagcagcccccgcagccgccgcaccacctgccccagcagctcccggtg cagcacccgcggctgcaggccttgaaggaggagccgcagacggtgcccgagatgcccggg gaaacgccgcccctgtcccccatcgacatggagtcgcaggagaggatcaaggcagagagg aagcgcatgaggaaccgcatagctgcctccaagtgccggaaaaggaagctggagaggatc gcccggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtccacg gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac agtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system