Lutra lutra (Eurasian river otter): 125098683 Help Entry 125098683         CDS       T08100                                  Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism llv  Lutra lutra (Eurasian river otter) Pathway llv04015   Rap1 signaling pathway llv04810   Regulation of actin cytoskeleton llv05014   Amyotrophic lateral sclerosis llv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:llv00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     125098683  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     125098683  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125098683   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     125098683  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:llv04131]     125098683   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:llv04812]     125098683    04147 Exosome [BR:llv04147]     125098683 Membrane trafficking [BR:llv04131]  Others   Actin-binding proteins    Others     125098683 Cytoskeleton proteins [BR:llv04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      125098683 Exosome [BR:llv04147]  Exosomal proteins   Proteins found in most exosomes    125098683 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  125098683 NCBI-ProteinID:  XP_047583678 LinkDB All DBs Position 1:complement(76883037..76901579) Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVH GGTLNKKAYELALYLRRSDV NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc cagagcatcacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggcgcaaagaagtgctcggtgatcagagatagcctatacgtc gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaac gttgctgtcggcagagctggtagagcattggttatagtcatgggaaaggaaggtgtccac ggaggcacacttaacaagaaagcatatgaactcgctttatacctgaggaggtctgatgtg taa

DBGET integrated database retrieval system