Lutra lutra (Eurasian river otter): 125099136 Help Entry 125099136         CDS       T08100                                  Name (RefSeq) polyubiquitin   KO K04551   ubiquitin B Organism llv  Lutra lutra (Eurasian river otter) Pathway llv04120   Ubiquitin mediated proteolysis llv04137   Mitophagy - animal llv04140   Autophagy - animal llv05012   Parkinson disease llv05022   Pathways of neurodegeneration - multiple diseases llv05167   Kaposi sarcoma-associated herpesvirus infection Brite KEGG Orthology (KO) [BR:llv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     125099136  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     125099136    04137 Mitophagy - animal     125099136  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     125099136   09164 Neurodegenerative disease    05012 Parkinson disease     125099136    05022 Pathways of neurodegeneration - multiple diseases     125099136  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:llv04121]     125099136   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:llv04147]     125099136 Ubiquitin system [BR:llv04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    125099136 Exosome [BR:llv04147]  Exosomal proteins   Exosomal proteins of breast milk    125099136   Exosomal proteins of other body fluids (saliva and urine)    125099136   Exosomal proteins of colorectal cancer cells    125099136   Exosomal proteins of bladder cancer cells    125099136 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 DUF2604 Rad60-SLD_2 TBK1_ULD Ubiquitin_5 OTU1_UBXL Dsc3_N HATPase_c UBL_UBAC1 Motif Other DBs NCBI-GeneID:  125099136 NCBI-ProteinID:  XP_047584477 LinkDB All DBs Position 1:81412213..81412943 Genome browser AA seq 153 aa AA seqDB search MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgcagatcttcgtgaagaccctgaccggcaagaccatcaccctggaggtggagcccagt gacaccatcgaaaatgtgaaggccaagatccaagacaaagaaggcatcccccctgaccag cagaggcttatctttgccggcaagcagctggaagatggccgcactctttctgattacaac atccagaaagagtccaccctgcacctggtcctgcgcctgagaggtggcatgcagatcttc gtgaagaccctgaccggcaagaccatcaccctggaggtggagcctagtgacaccatcgaa aatgtaaaggccaagatccaagataaagagggcatcccccctgaccagcagaggcttatc tttgccggcaagcagctagaagatggccgcactctttctgattacaacatccagaaagag tcaactctccacctggttctccgtctgaggggtggctgttaa

DBGET integrated database retrieval system