Lutra lutra (Eurasian river otter): 125099197 Help Entry 125099197         CDS       T08100                                  Name (RefSeq) histone H2B type 2-F isoform X1   KO K11252   histone H2B Organism llv  Lutra lutra (Eurasian river otter) Pathway llv04613   Neutrophil extracellular trap formation llv05034   Alcoholism llv05203   Viral carcinogenesis llv05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:llv00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     125099197  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     125099197   09163 Immune disease    05322 Systemic lupus erythematosus     125099197   09165 Substance dependence    05034 Alcoholism     125099197  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:llv03036]     125099197   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:llv04147]     125099197 Chromosome and associated proteins [BR:llv03036]  Eukaryotic type   Nucleosome assembly factors    Histones     125099197 Exosome [BR:llv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125099197 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like Motif Other DBs NCBI-GeneID:  125099197 NCBI-ProteinID:  XP_047584560 LinkDB All DBs Position 4:91459334..91499904 Genome browser AA seq 145 aa AA seqDB search MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSKPFSALSEEMVFKVTARLQS NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atgcctgacccagcaaagtcggctcctgctcccaagaaaggctctaagaaagctgttacc aaggtgcagaagaaggacggcaagaagcgcaagcgtagccgcaaggagagctattccgtt tacgtgtataaagtgttgaagcaggtgcacccggacaccggcatctcctccaaggccatg ggcatcatgaactctttcgtcaacgacatttttgagcgtatcgccggcgaggcctcccgc ctggcgcattacaacaagcgctccaccatcacgtcgcgggagatccagacggccgtgcgc ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggcggtcacc aagtacaccagctcgaagcctttttctgccctttcagaagaaatggtcttcaaagtcaca gccagactccagagctga

DBGET integrated database retrieval system