Lutra lutra (Eurasian river otter): 125099755 Help Entry 125099755         CDS       T08100                                  Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism llv  Lutra lutra (Eurasian river otter) Pathway llv04060   Cytokine-cytokine receptor interaction llv04630   JAK-STAT signaling pathway llv04640   Hematopoietic cell lineage llv04657   IL-17 signaling pathway llv04658   Th1 and Th2 cell differentiation llv04660   T cell receptor signaling pathway llv04664   Fc epsilon RI signaling pathway llv04672   Intestinal immune network for IgA production llv05200   Pathways in cancer llv05310   Asthma llv05320   Autoimmune thyroid disease llv05321   Inflammatory bowel disease llv05330   Allograft rejection Brite KEGG Orthology (KO) [BR:llv00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     125099755   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125099755  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     125099755    04660 T cell receptor signaling pathway     125099755    04658 Th1 and Th2 cell differentiation     125099755    04657 IL-17 signaling pathway     125099755    04664 Fc epsilon RI signaling pathway     125099755    04672 Intestinal immune network for IgA production     125099755  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125099755   09163 Immune disease    05310 Asthma     125099755    05320 Autoimmune thyroid disease     125099755    05321 Inflammatory bowel disease     125099755    05330 Allograft rejection     125099755  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:llv04052]     125099755    00536 Glycosaminoglycan binding proteins [BR:llv00536]     125099755 Cytokines and neuropeptides [BR:llv04052]  Cytokines   Interleukins    125099755 Glycosaminoglycan binding proteins [BR:llv00536]  Heparan sulfate / Heparin   Cytokines    125099755 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  125099755 NCBI-ProteinID:  XP_047585088 LinkDB All DBs Position 5:complement(71892598..71895169) Genome browser AA seq 134 aa AA seqDB search MRLLLHLSLLALGAAYVSVTAVESPMNRLVAETLTLLSTHRTLLIGDGNLMIPTPENKNH QLCIEEVFQGIDILKNQTAQAAAVDKLFRNLSFIKAHIDSQKKKCGGERWRVKKFLDYLQ VFLGVINTEWTTES NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgagactgcttctgcatttgagtttgctagctcttggggctgcctatgtttctgtcact gctgtagaaagtcccatgaacagactggtggcagagaccttgacactgctctccactcat cgaactctgctgataggtgacgggaacctgatgattcctactcctgaaaataaaaatcac caactgtgcatcgaagaagtctttcagggtatagacatattaaagaaccaaactgcacaa gcagcggctgtggataaactattccgaaatttgtctttcataaaagcacatatagacagc caaaaaaaaaaatgtggaggagaaagatggagagtaaaaaagttcctagactacctgcaa gtgtttcttggtgtcataaacactgagtggacaacagaaagttga

DBGET integrated database retrieval system