Lutra lutra (Eurasian river otter): 125100949 Help Entry 125100949         CDS       T08100                                  Name (RefSeq) histone H3.1-like   KO K11253   histone H3 Organism llv  Lutra lutra (Eurasian river otter) Pathway llv04613   Neutrophil extracellular trap formation llv05034   Alcoholism llv05202   Transcriptional misregulation in cancer llv05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:llv00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     125100949  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     125100949   09163 Immune disease    05322 Systemic lupus erythematosus     125100949   09165 Substance dependence    05034 Alcoholism     125100949  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:llv03036]     125100949   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:llv04147]     125100949 Chromosome and associated proteins [BR:llv03036]  Eukaryotic type   Nucleosome assembly factors    Histones     125100949 Exosome [BR:llv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125100949 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  125100949 NCBI-ProteinID:  XP_047587456 LinkDB All DBs Position 5:162710543..162711239 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVTALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgcacgaagcagacggcgcgcaagtccacaggcggcaaggcaccacgcaagcag ctggccacgaaagtggcccgtaagagcgcgccggcaacaggcggcgttaagaagccacac cgctaccggcctggcacggtggctctgcgcgagatccggcgctaccagaagtctaccgag cttctgatccgcaagctgccgttccagcggctggtgcgtgaaatcgcgcaggatttcaag accgacctgcgcttccagagctcggcggtcacggcactgcaggaggcgtgtgaggcctac ctggtggggctgttcgaggacaccaacctgtgcgccatccacgccaagcgggtcactatc atgcccaaggacatccagctggcgcgccgcatccgcggggagcgcgcctaa

DBGET integrated database retrieval system