Lutra lutra (Eurasian river otter): 125101000 Help Entry 125101000         CDS       T08100                                  Name (RefSeq) profilin-3   KO K05759   profilin Organism llv  Lutra lutra (Eurasian river otter) Pathway llv04015   Rap1 signaling pathway llv04810   Regulation of actin cytoskeleton llv05014   Amyotrophic lateral sclerosis llv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:llv00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     125101000  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     125101000  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125101000   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     125101000  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:llv04131]     125101000   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:llv04812]     125101000    04147 Exosome [BR:llv04147]     125101000 Membrane trafficking [BR:llv04131]  Others   Actin-binding proteins    Others     125101000 Cytoskeleton proteins [BR:llv04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      125101000 Exosome [BR:llv04147]  Exosomal proteins   Proteins found in most exosomes    125101000 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  125101000 NCBI-ProteinID:  XP_047587547 LinkDB All DBs Position 5:complement(66350990..66351557) Genome browser AA seq 137 aa AA seqDB search MGDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGHDRRTFL QSGLSVAGRRCCVIRDHLLSEGDGVLDARTKGLDGRAVCVGHTPRVLLVLMGRRGVHGGI LNKTVHELIKGLRKQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggagactggaagggctatatcagtgcggtgttgcgtgaccagcgcattgacgacgtg gccatcgtgggtcactcagacaatcgctgcgtgtgggcatcgcgccccggaggccttctg gctgccatatcgccgcaggaggtgggtgtgctcacagggcatgaccggcgcaccttcttg cagtcgggcctcagcgtggcgggccgccgctgctgcgtcatccgcgaccacttgctgtct gagggcgatggagttctggacgcgcgcaccaaggggctggatgggcgcgcggtctgcgtc ggccacaccccgcgcgtgctcctcgtgctcatgggccggcgcggcgtgcacgggggcatc ctcaataagacggtgcatgaactgatcaagggtctgcgaaagcagggcacctag

DBGET integrated database retrieval system