Lutra lutra (Eurasian river otter): 125101659 Help Entry 125101659         CDS       T08100                                  Name (RefSeq) profilin-1-like   KO K05759   profilin Organism llv  Lutra lutra (Eurasian river otter) Pathway llv04015   Rap1 signaling pathway llv04810   Regulation of actin cytoskeleton llv05014   Amyotrophic lateral sclerosis llv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:llv00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     125101659  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     125101659  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125101659   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     125101659  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:llv04131]     125101659   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:llv04812]     125101659    04147 Exosome [BR:llv04147]     125101659 Membrane trafficking [BR:llv04131]  Others   Actin-binding proteins    Others     125101659 Cytoskeleton proteins [BR:llv04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      125101659 Exosome [BR:llv04147]  Exosomal proteins   Proteins found in most exosomes    125101659 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  125101659 NCBI-ProteinID:  XP_047587972 LinkDB All DBs Position 6:115437049..115437673 Genome browser AA seq 129 aa AA seqDB search MRDRTCQDAAIMGSKDSPSVCAAIPGKTFVNIKPAEVGVLVGKDRSSFFMSGLTLGDQKC SVIQDSLLQDGEFTMDFCTKSTGGAPTFNITVTMTAKMLVLLMGKEGVHGGMINKKCYEM ASYLRHSQY NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagagaccggacctgtcaggacgcggccatcatgggctctaaggactcgccctccgtc tgcgccgccatccccggaaagaccttcgtcaacatcaaaccagctgaggttggtgtcctg gttggcaaagaccggtcaagttttttcatgagtgggctgacacttggggaccagaaatgt tctgttatccaggactcactgctgcaggatggggagttcaccatggacttttgtaccaag agcaccggtggagcccccactttcaacatcactgtcaccatgactgccaagatgctagtc ctgctgatgggcaaagaaggtgtccacggtggtatgatcaacaagaaatgttatgaaatg gcctcctacctgcggcattcccagtactga

DBGET integrated database retrieval system