Lutra lutra (Eurasian river otter): 125102071 Help Entry 125102071         CDS       T08100                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism llv  Lutra lutra (Eurasian river otter) Pathway llv04613   Neutrophil extracellular trap formation llv05034   Alcoholism llv05203   Viral carcinogenesis llv05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:llv00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     125102071  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     125102071   09163 Immune disease    05322 Systemic lupus erythematosus     125102071   09165 Substance dependence    05034 Alcoholism     125102071  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:llv03036]     125102071 Chromosome and associated proteins [BR:llv03036]  Eukaryotic type   Nucleosome assembly factors    Histones     125102071 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  125102071 NCBI-ProteinID:  XP_047588732 LinkDB All DBs Position 6:2015499..2015881 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggcaagggcgggaagggcctgggcaaggggggcgccaagcgccaccgc aaagtgctgcgcgacaacatccagggcatcaccaagcccgccatccggcggctggcccgg cgcggcggcgtcaagcgcatctccggcctcatctacgaggagacccgcggggtgctcaag gtgttcctggagaacgtgatccgcgacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtctacgcgctcaagcgccagggccgcaccctctacggc ttcgggggctga

DBGET integrated database retrieval system