Lutra lutra (Eurasian river otter): 125102594 Help Entry 125102594         CDS       T08100                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism llv  Lutra lutra (Eurasian river otter) Pathway llv04613   Neutrophil extracellular trap formation llv05034   Alcoholism llv05202   Transcriptional misregulation in cancer llv05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:llv00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     125102594  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     125102594   09163 Immune disease    05322 Systemic lupus erythematosus     125102594   09165 Substance dependence    05034 Alcoholism     125102594  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:llv03036]     125102594   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:llv04147]     125102594 Chromosome and associated proteins [BR:llv03036]  Eukaryotic type   Nucleosome assembly factors    Histones     125102594 Exosome [BR:llv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125102594 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom Motif Other DBs NCBI-GeneID:  125102594 NCBI-ProteinID:  XP_047589886 LinkDB All DBs Position 6:complement(2485362..2486641) Genome browser AA seq 120 aa AA seqDB search MYGRLPLLRFAQLATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQD FKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDTRVPYRLMEGLITG NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgtacggtagattgccacttttgagatttgcacagttggctacgggcggcgtgaagaag ccgcaccgctaccggcccggcacggtcgccctgcgcgagatccggcgctaccagaagtcc accgagctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggac ttcaagaccgacctgcgcttccagagctcggccgtcatggcgctgcaggaggcgtgcgag gcctacctggtggggctcttcgaggacaccaacctctgcgccatccacgccaaacgcgtc accatcatgcccaaggacacccgggtcccctacaggttaatggagggcctcattacagga tag

DBGET integrated database retrieval system