Lutra lutra (Eurasian river otter): 125105211 Help Entry 125105211         CDS       T08100                                  Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism llv  Lutra lutra (Eurasian river otter) Pathway llv04024   cAMP signaling pathway llv04062   Chemokine signaling pathway llv04064   NF-kappa B signaling pathway llv04210   Apoptosis llv04380   Osteoclast differentiation llv04620   Toll-like receptor signaling pathway llv04621   NOD-like receptor signaling pathway llv04622   RIG-I-like receptor signaling pathway llv04623   Cytosolic DNA-sensing pathway llv04625   C-type lectin receptor signaling pathway llv04657   IL-17 signaling pathway llv04658   Th1 and Th2 cell differentiation llv04659   Th17 cell differentiation llv04660   T cell receptor signaling pathway llv04662   B cell receptor signaling pathway llv04668   TNF signaling pathway llv04722   Neurotrophin signaling pathway llv04920   Adipocytokine signaling pathway llv04926   Relaxin signaling pathway llv04931   Insulin resistance llv04936   Alcoholic liver disease llv05132   Salmonella infection llv05134   Legionellosis llv05135   Yersinia infection llv05140   Leishmaniasis llv05142   Chagas disease llv05145   Toxoplasmosis llv05160   Hepatitis C llv05161   Hepatitis B llv05162   Measles llv05163   Human cytomegalovirus infection llv05164   Influenza A llv05166   Human T-cell leukemia virus 1 infection llv05167   Kaposi sarcoma-associated herpesvirus infection llv05168   Herpes simplex virus 1 infection llv05169   Epstein-Barr virus infection llv05170   Human immunodeficiency virus 1 infection llv05171   Coronavirus disease - COVID-19 llv05200   Pathways in cancer llv05203   Viral carcinogenesis llv05208   Chemical carcinogenesis - reactive oxygen species llv05215   Prostate cancer llv05220   Chronic myeloid leukemia llv05222   Small cell lung cancer llv05235   PD-L1 expression and PD-1 checkpoint pathway in cancer llv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:llv00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     125105211    04668 TNF signaling pathway     125105211    04024 cAMP signaling pathway     125105211  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     125105211  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     125105211    04621 NOD-like receptor signaling pathway     125105211    04622 RIG-I-like receptor signaling pathway     125105211    04623 Cytosolic DNA-sensing pathway     125105211    04625 C-type lectin receptor signaling pathway     125105211    04660 T cell receptor signaling pathway     125105211    04658 Th1 and Th2 cell differentiation     125105211    04659 Th17 cell differentiation     125105211    04657 IL-17 signaling pathway     125105211    04662 B cell receptor signaling pathway     125105211    04062 Chemokine signaling pathway     125105211   09152 Endocrine system    04920 Adipocytokine signaling pathway     125105211    04926 Relaxin signaling pathway     125105211   09156 Nervous system    04722 Neurotrophin signaling pathway     125105211   09158 Development and regeneration    04380 Osteoclast differentiation     125105211  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125105211    05208 Chemical carcinogenesis - reactive oxygen species     125105211    05203 Viral carcinogenesis     125105211    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     125105211   09162 Cancer: specific types    05220 Chronic myeloid leukemia     125105211    05215 Prostate cancer     125105211    05222 Small cell lung cancer     125105211   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     125105211    05170 Human immunodeficiency virus 1 infection     125105211    05161 Hepatitis B     125105211    05160 Hepatitis C     125105211    05171 Coronavirus disease - COVID-19     125105211    05164 Influenza A     125105211    05162 Measles     125105211    05168 Herpes simplex virus 1 infection     125105211    05163 Human cytomegalovirus infection     125105211    05167 Kaposi sarcoma-associated herpesvirus infection     125105211    05169 Epstein-Barr virus infection     125105211   09171 Infectious disease: bacterial    05132 Salmonella infection     125105211    05135 Yersinia infection     125105211    05134 Legionellosis     125105211   09174 Infectious disease: parasitic    05145 Toxoplasmosis     125105211    05140 Leishmaniasis     125105211    05142 Chagas disease     125105211   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125105211   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     125105211    04931 Insulin resistance     125105211  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:llv03000]     125105211    04131 Membrane trafficking [BR:llv04131]     125105211 Transcription factors [BR:llv03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     125105211 Membrane trafficking [BR:llv04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     125105211 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  125105211 NCBI-ProteinID:  XP_047594386 LinkDB All DBs Position 7:complement(84891617..84894918) Genome browser AA seq 314 aa AA seqDB search MFQPAEHNQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQLVKELKEIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLTFLNFQNNLQQTPLHLAVI TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCRTQHLSSVLQATN YNGHTCLHLASIRGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNSDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLESLQMLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgtttcagcccgccgagcacaaccaggactgggccatggagggtccccgggacgcgctc aagaaggagcgcctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtacgagcagttggtgaaggaattgaaggagatccgcctcgagccgcaggaggcgccg cgcggcgccgagccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg gccatcatccatgaagagaaggcactgaccatggaagtgatccgccaagtgaagggcgac ctgacctttctcaacttccagaacaacctgcagcagactccactccacttggccgtgatc accaaccaaccagaaattgctgaggcacttctggaagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacaccttgcctgtgagcaaggctgcctggccagtgtg ggagtcctgactcagacctgcaggacccagcacctctcctccgtcctccaggccactaac tacaatgggcacacgtgtctacatttagcctctatccgtggctacttgggcattgtggag cttctggtgtctctgggtgctgacgtcaatgctcaggagccctgcaatggccgaaccgcc ctccatctcgccgtggacctgcagaattctgatctcgtgtcgctcttgttgaagtgtggg gctgatgtcaacagagttacctaccagggctactccccgtaccagctcacctggggccgc ccaagcacgcggatacagcagcagctgggccagctgaccctagaaagccttcagatgttg ccagagagcgaggatgaggagagctacgacacggagtcagagttcacggaggacgagctg ccctatgatgactgtgtgcttggaggccagcgcctgacgttataa

DBGET integrated database retrieval system