Lutra lutra (Eurasian river otter): 125108268 Help Entry 125108268         CDS       T08100                                  Name (RefSeq) protein dpy-30 homolog   KO K14965   protein dpy-30 Organism llv  Lutra lutra (Eurasian river otter) Brite KEGG Orthology (KO) [BR:llv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:llv03036]     125108268 Chromosome and associated proteins [BR:llv03036]  Eukaryotic type   Histone modification proteins    HMT complexes     COMPASS/SET1 complex      125108268     MLL-HCF complex      125108268     MLL3/MLL4 complex      125108268 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dpy-30 RIIa DUF7205 Motif Other DBs NCBI-GeneID:  125108268 NCBI-ProteinID:  XP_047599780 LinkDB All DBs Position 9:complement(25808108..25819785) Genome browser AA seq 99 aa AA seqDB search MEPEQMLEGQTQVAENPHSEYGLTDNVERIVDNEKINAEKSSKQKVDLQSLPTRAYLDQT VVPILLQGLAVLAKERPPNPIEFLASYLLKNKAQFEDRN NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggagccagagcagatgctggagggacagacgcaggttgcagaaaaccctcactctgag tacggtctcacagacaatgtcgagaggatagtagacaatgagaagattaatgcagaaaag tcatcaaaacagaaagtggatctccagtctttgccaactcgtgcctacctggatcagaca gttgtgcctattttattacagggacttgctgtgcttgcgaaagaaagaccaccaaatccc attgaatttctagcatcctatcttttaaaaaacaaggcacagtttgaagatcgaaactga

DBGET integrated database retrieval system