Lutra lutra (Eurasian river otter): 125109148 Help Entry 125109148         CDS       T08100                                  Name (RefSeq) interleukin-1 beta   KO K04519   interleukin 1 beta Organism llv  Lutra lutra (Eurasian river otter) Pathway llv01523   Antifolate resistance llv04010   MAPK signaling pathway llv04060   Cytokine-cytokine receptor interaction llv04064   NF-kappa B signaling pathway llv04217   Necroptosis llv04380   Osteoclast differentiation llv04620   Toll-like receptor signaling pathway llv04621   NOD-like receptor signaling pathway llv04623   Cytosolic DNA-sensing pathway llv04625   C-type lectin receptor signaling pathway llv04640   Hematopoietic cell lineage llv04657   IL-17 signaling pathway llv04659   Th17 cell differentiation llv04668   TNF signaling pathway llv04750   Inflammatory mediator regulation of TRP channels llv04932   Non-alcoholic fatty liver disease llv04933   AGE-RAGE signaling pathway in diabetic complications llv04936   Alcoholic liver disease llv04940   Type I diabetes mellitus llv05010   Alzheimer disease llv05020   Prion disease llv05022   Pathways of neurodegeneration - multiple diseases llv05132   Salmonella infection llv05133   Pertussis llv05134   Legionellosis llv05135   Yersinia infection llv05140   Leishmaniasis llv05142   Chagas disease llv05143   African trypanosomiasis llv05144   Malaria llv05146   Amoebiasis llv05152   Tuberculosis llv05162   Measles llv05163   Human cytomegalovirus infection llv05164   Influenza A llv05168   Herpes simplex virus 1 infection llv05171   Coronavirus disease - COVID-19 llv05321   Inflammatory bowel disease llv05323   Rheumatoid arthritis llv05332   Graft-versus-host disease llv05417   Lipid and atherosclerosis llv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:llv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     125109148    04064 NF-kappa B signaling pathway     125109148    04668 TNF signaling pathway     125109148   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125109148  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     125109148  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     125109148    04620 Toll-like receptor signaling pathway     125109148    04621 NOD-like receptor signaling pathway     125109148    04623 Cytosolic DNA-sensing pathway     125109148    04625 C-type lectin receptor signaling pathway     125109148    04659 Th17 cell differentiation     125109148    04657 IL-17 signaling pathway     125109148   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     125109148   09158 Development and regeneration    04380 Osteoclast differentiation     125109148  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     125109148    05164 Influenza A     125109148    05162 Measles     125109148    05168 Herpes simplex virus 1 infection     125109148    05163 Human cytomegalovirus infection     125109148   09171 Infectious disease: bacterial    05132 Salmonella infection     125109148    05135 Yersinia infection     125109148    05133 Pertussis     125109148    05134 Legionellosis     125109148    05152 Tuberculosis     125109148   09174 Infectious disease: parasitic    05146 Amoebiasis     125109148    05144 Malaria     125109148    05140 Leishmaniasis     125109148    05142 Chagas disease     125109148    05143 African trypanosomiasis     125109148   09163 Immune disease    05323 Rheumatoid arthritis     125109148    05321 Inflammatory bowel disease     125109148    05332 Graft-versus-host disease     125109148   09164 Neurodegenerative disease    05010 Alzheimer disease     125109148    05020 Prion disease     125109148    05022 Pathways of neurodegeneration - multiple diseases     125109148   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125109148    05418 Fluid shear stress and atherosclerosis     125109148   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     125109148    04936 Alcoholic liver disease     125109148    04932 Non-alcoholic fatty liver disease     125109148    04933 AGE-RAGE signaling pathway in diabetic complications     125109148   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     125109148  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:llv04052]     125109148    00536 Glycosaminoglycan binding proteins [BR:llv00536]     125109148 Cytokines and neuropeptides [BR:llv04052]  Cytokines   Interleukins    125109148 Glycosaminoglycan binding proteins [BR:llv00536]  Heparan sulfate / Heparin   Cytokines    125109148 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1 IL1_propep Motif Other DBs NCBI-GeneID:  125109148 NCBI-ProteinID:  XP_047601784 LinkDB All DBs Position 9:complement(37873236..37879792) Genome browser AA seq 270 aa AA seqDB search MARVPEPTSEVMSYGYSDNENDLFFEADGPGKMKCCFQDLNNSYLEEEGIQLHISHQLHN KSLSHFVSVVVALEKLKKISVPCSLPLQDDDLMNVFHCIFAEEPIIFEKCDDDGFVHDAP PRSLDCKFQDINQKSLVLYNSYELRALHLNGTSVNQQAVFRMTFVQEDEDNSKIPVALCI KEKNLYLSCVMKDGKPTLQLEMLDPKVYPKKRMEKRFVFNKTEIKKKVEFESSQFPNWYI STSQAEAMPVFLGNNRGGHDITDFTMELSS NT seq 813 nt NT seq  +upstreamnt  +downstreamnt atggcaagagtacctgaacccaccagtgaagtgatgtcttatggctacagtgacaatgag aatgaccttttctttgaggctgatggtcctggaaagatgaagtgctgcttccaagacctg aacaatagctatctggaagaggagggcatccagcttcacatctcccaccagctccataac aagagtctgagccatttcgtgtcagtcgttgtggctttggagaagctgaagaagatatct gtaccctgctcactgcccctccaggatgatgacctgatgaacgtttttcactgcatcttt gcagaagaacccatcatctttgaaaagtgtgatgatgacggctttgttcatgatgcaccc ccacgatccttggactgcaaattccaggacataaaccaaaaatccttggtgctgtataac tcgtatgagcttcgggccctccacctcaacggaactagtgtgaaccaacaagcggtgttc cgcatgaccttcgtgcaagaggatgaagataatagcaagatacctgtggccttgtgcatc aaggaaaagaatctgtacctgtcctgtgtgatgaaagatgggaagcccaccttgcagctg gagatgttagaccccaaagtttacccaaagaagaggatggaaaagcgatttgtcttcaac aagacagaaatcaagaaaaaggtggaatttgagtcttcccagtttcccaactggtacatc agcacctctcaggcagaagcaatgcctgtcttcctgggaaataacagaggtggtcacgac ataactgacttcaccatggaactctcttcctag

DBGET integrated database retrieval system