Novilysobacter luteus: LYB30171_00976 Help Entry LYB30171_00976    CDS       T08395                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism llz  Novilysobacter luteus Pathway llz01100   Metabolic pathways llz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:llz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LYB30171_00976 (acpP)    00074 Mycolic acid biosynthesis     LYB30171_00976 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LYB30171_00976 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 Motif Other DBs NCBI-ProteinID:  CAG4971454 UniProt:  A0ABM8UEB1 LinkDB All DBs Position 1:1039889..1040128 Genome browser AA seq 79 aa AA seqDB search MSSIEERVKKIVVEQLGVKEDEVTNNASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITSVQQAIDYVKAHVKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcagcatcgaagagcgcgtcaagaagatcgtggttgagcagctgggcgtgaaggaa gacgaggtcaccaacaacgcttcgttcgtcgacgacctgggtgccgattcgctcgacacc gtcgagctggtgatggcgctcgaggaagagttcgagtgcgagatcccggacgaggaagcc gaaaagatcacttcggtccagcaggcgatcgattacgtcaaggcgcacgtcaagtcgtaa

DBGET integrated database retrieval system