Leishmania major: LMJF_09_1130
Help
Entry
LMJF_09_1130 CDS
T01014
Name
(RefSeq) putative inner membrane preprotein translocase Tim17
KO
K17795
mitochondrial import inner membrane translocase subunit TIM17
Organism
lma
Leishmania major
Brite
KEGG Orthology (KO) [BR:
lma00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03029 Mitochondrial biogenesis [BR:
lma03029
]
LMJF_09_1130
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
lma02000
]
LMJF_09_1130
Mitochondrial biogenesis [BR:
lma03029
]
Mitochondrial protein import machinery
Inner mambrane
TIM23 complex
LMJF_09_1130
Transporters [BR:
lma02000
]
Other transporters
Primary active transporters [TC:
3
]
LMJF_09_1130
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Tim17
Hpt
Motif
Other DBs
NCBI-GeneID:
5649553
NCBI-ProteinID:
XP_001681286
UniProt:
Q4QHR2
LinkDB
All DBs
Position
9:complement(449115..449573)
Genome browser
AA seq
152 aa
AA seq
DB search
MTSILDPRQPIEPLQRAMMVAKDSTLATAMLNVFGGYVMGFGFSLFGSMISAETSTQAMG
TADFFRHSLRSAHRLGGSFAFFGFVFGGIEVALEKRRGRKDQWNPTIAGAIIGGGYGWRS
YKHPGLAAGIVGGAAFSLVFEKMLDAMGMAQH
NT seq
459 nt
NT seq
+upstream
nt +downstream
nt
atgacatccatcttggaccctaggcagcccatcgagcccctccagcgggcgatgatggta
gccaaagacagcacgctggctacggcaatgttgaacgtgtttggtggctacgtcatgggc
ttcggtttttcgctcttcggctccatgatctcggccgagacaagcacgcaggcgatggga
acggcagacttcttccgccacagcctgcgcagcgctcaccgcctcggcggcagcttcgcc
ttcttcggcttcgtattcggcggcatcgaggtggcgttagagaagcgtcgcggccgcaag
gaccaatggaatccgacgattgccggcgctatcattggtggcgggtatgggtggcgctcc
tacaagcaccccggtctggcggccggcatcgtcggtggtgcggccttctctctggttttc
gagaagatgctggatgccatgggcatggcccagcactaa
DBGET
integrated database retrieval system