Leishmania major: LMJF_25_1315 Help Entry LMJF_25_1315      CDS       T01014                                  Name (RefSeq) DNA-directed RNA polymerase II   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism lma  Leishmania major Pathway lma03020   RNA polymerase lma03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:lma00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     LMJF_25_1315   09124 Replication and repair    03420 Nucleotide excision repair     LMJF_25_1315  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:lma03021]     LMJF_25_1315    03400 DNA repair and recombination proteins [BR:lma03400]     LMJF_25_1315 Transcription machinery [BR:lma03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      LMJF_25_1315   RNA polymerase III system    RNA polymerase III      LMJF_25_1315   RNA polymerase I system    RNA polymerase I      LMJF_25_1315 DNA repair and recombination proteins [BR:lma03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       LMJF_25_1315 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_N Yippee-Mis18 UBA Motif Other DBs NCBI-GeneID:  12981313 NCBI-ProteinID:  XP_003721802 UniProt:  E9ACT0 LinkDB All DBs Position 25:complement(523535..523789) Genome browser AA seq 84 aa AA seqDB search MIIPVRCYSCGKVVGNLYEQYQRLLDQDYTEAEALDALHLDRYCCRRMILSHIDLIDDLI PYSVPVTGTMQMIGPLQMPTPHRR NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgatcatcccggtgcgttgctactcgtgcggtaaggtggtcggcaacctctacgagcag tatcagcggcttttggatcaggactacacggaggccgaggcgctggatgcgctgcatctg gatcgctactgctgccgtcgcatgatcctctcccatattgatctgatcgacgacctcatt ccttatagcgtacctgtgacaggcaccatgcagatgatagggccgctgcagatgcccacg ccgcaccgccgctga

DBGET integrated database retrieval system