Leishmania martiniquensis: 92513304 Help Entry 92513304          CDS       T10333                                  Symbol LSCM1_03244 Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism lmat  Leishmania martiniquensis Pathway lmat04145   Phagocytosis lmat04517   IgSF CAM signaling lmat04814   Motor proteins Brite KEGG Orthology (KO) [BR:lmat00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     92513304 (LSCM1_03244)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     92513304 (LSCM1_03244)   09142 Cell motility    04814 Motor proteins     92513304 (LSCM1_03244)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:lmat03037]     92513304 (LSCM1_03244)    04812 Cytoskeleton proteins [BR:lmat04812]     92513304 (LSCM1_03244) Cilium and associated proteins [BR:lmat03037]  Motile cilia and associated proteins   Dynein arm    92513304 (LSCM1_03244) Cytoskeleton proteins [BR:lmat04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      92513304 (LSCM1_03244) SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light PapC_C TINF2_N Motif Other DBs NCBI-GeneID:  92513304 NCBI-ProteinID:  XP_067177402 UniProt:  A0A836HCQ6 LinkDB All DBs Position 28:<845192..>845464 Genome browser AA seq 90 aa AA seqDB search MTQVPNATVKLSEMPKEMENFAIFCAQEGLAKLQTAQELASFVRKEFENKYGPTWNCFVG RNFGSFVTHEEGNYVYFYVGQTGVLLFKSS NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgacgcaggtacctaacgcgacggtgaagctctccgagatgccgaaggagatggagaac tttgccattttttgtgctcaggaggggctggcgaaactgcaaactgcgcaggagcttgcc agttttgttcgaaaggagtttgaaaacaagtatgggccaacgtggaactgttttgtcggc cgaaacttcggcagtttcgttacgcatgaagagggtaactacgtgtacttctacgttggt caaactggcgttctgcttttcaagtcctcgtag

DBGET integrated database retrieval system