Leishmania martiniquensis: 92515206 Help Entry 92515206          CDS       T10333                                  Symbol LSCM1_05221 Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism lmat  Leishmania martiniquensis Pathway lmat04145   Phagocytosis lmat04517   IgSF CAM signaling lmat04814   Motor proteins Brite KEGG Orthology (KO) [BR:lmat00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     92515206 (LSCM1_05221)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     92515206 (LSCM1_05221)   09142 Cell motility    04814 Motor proteins     92515206 (LSCM1_05221)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:lmat03037]     92515206 (LSCM1_05221)    04812 Cytoskeleton proteins [BR:lmat04812]     92515206 (LSCM1_05221) Cilium and associated proteins [BR:lmat03037]  Motile cilia and associated proteins   Dynein arm    92515206 (LSCM1_05221) Cytoskeleton proteins [BR:lmat04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      92515206 (LSCM1_05221) SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  92515206 NCBI-ProteinID:  XP_067178059 UniProt:  A0A836GQA6 LinkDB All DBs Position 25:complement(<78305..>78574) Genome browser AA seq 89 aa AA seqDB search MSERKLDVKVADMSPEMQADALDIATKAIKGHQLEKEMAAHIKREFDKRYYPTWHCIVGR NFGADVEHETKNFIYLYVGQLSVLLWKTA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcgagcggaagctcgacgttaaggtggcggacatgagtccagagatgcaggcagac gccttagatatcgccaccaaagccatcaaagggcatcagctagagaaggagatggccgcg cacatcaagcgcgagttcgacaagcgctactaccccacgtggcactgcattgtggggcgc aatttcggtgccgatgttgagcacgagacgaaaaacttcatttacctgtacgttggacaa ttgtcagtgctattgtggaagaccgcgtag

DBGET integrated database retrieval system