Marilutibacter maris: C9I47_0290 Help Entry C9I47_0290        CDS       T05495                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lmb  Marilutibacter maris Pathway lmb01100   Metabolic pathways lmb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lmb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C9I47_0290    00074 Mycolic acid biosynthesis     C9I47_0290   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C9I47_0290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding zf_Hakai Motif Other DBs NCBI-ProteinID:  AWV06015 UniProt:  A0A2U9T3R7 LinkDB All DBs Position 372838..373107 Genome browser AA seq 89 aa AA seqDB search MSEQTAAERELAELLVESLNLEGVAAEGIDPEAPLFGEGLGLDSIDALELALAITKRHGI QLRSDGDENRRIFASLRSLAAHIEQRKAA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtctgaacaaaccgccgccgagcgcgaactggccgagctgctggtcgagagcctgaat ctggaaggcgttgccgccgaaggcatcgatccggaggcgccgctgttcggcgaggggctg ggactggactcgatcgacgcgctggagctggcgctggcgatcaccaagcgtcatggcatc caactgcgttcggacggcgacgagaaccgccggatcttcgcatccctgcgctcgctggcg gcgcacatcgagcagcgcaaggcggcctga

DBGET integrated database retrieval system