Marilutibacter maris: C9I47_2781 Help Entry C9I47_2781        CDS       T05495                                  Name (GenBank) hypothetical protein   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism lmb  Marilutibacter maris Pathway lmb00290   Valine, leucine and isoleucine biosynthesis lmb00650   Butanoate metabolism lmb00660   C5-Branched dibasic acid metabolism lmb00770   Pantothenate and CoA biosynthesis lmb01100   Metabolic pathways lmb01110   Biosynthesis of secondary metabolites lmb01210   2-Oxocarboxylic acid metabolism lmb01230   Biosynthesis of amino acids Module lmb_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine lmb_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:lmb00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     C9I47_2781    00660 C5-Branched dibasic acid metabolism     C9I47_2781   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     C9I47_2781   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     C9I47_2781 Enzymes [BR:lmb01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      C9I47_2781 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 DUF3710 Permuted_GreAB-C Motif Other DBs NCBI-ProteinID:  AWV08452 UniProt:  A0A2U9TA40 LinkDB All DBs Position 3433966..3434148 Genome browser AA seq 60 aa AA seqDB search MLGAAERRGFRPLAVDGEAQPDGDRWHLRLTVEGERADTSLQTQLAKLYDCLAVEVSPCS NT seq 183 nt NT seq  +upstreamnt  +downstreamnt gtgctcggcgccgccgaacgccgcggcttccgtccgctcgcggtcgacggcgaagcccag cccgacggcgatcgctggcatctgcgcctgaccgtcgaaggcgaacgcgccgacacctcg ctgcagacgcagctggccaagctgtacgactgcctcgccgtggaggtgtcgccgtgcagc tag

DBGET integrated database retrieval system