Listeria monocytogenes FSL R2-561: LMKG_01550 Help Entry LMKG_01550        CDS       T01985                                  Name (GenBank) conserved hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism lmg  Listeria monocytogenes FSL R2-561 Pathway lmg03060   Protein export lmg03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:lmg00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     LMKG_01550  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     LMKG_01550  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:lmg02044]     LMKG_01550 Secretion system [BR:lmg02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    LMKG_01550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  AEO24661 LinkDB All DBs Position complement(388207..388386) Genome browser AA seq 59 aa AA seqDB search MIGPGSIALIVGAALVIFGPKKLPELGRAAGDTLREFKNATKGMMDDSKEETKKEDLRP NT seq 180 nt NT seq  +upstreamnt  +downstreamnt atgatcggaccaggaagtattgctttaattgtcggagccgcccttgtgatttttggacca aaaaaactgccagaacttggtagagctgctggagatactcttcgcgaattcaaaaatgcg accaaaggcatgatggatgattccaaagaagaaaccaaaaaagaagatctgcgcccgtga

DBGET integrated database retrieval system