KEGG   Lautropia mirabilis: NCTC12852_01388
Entry
NCTC12852_01388   CDS       T05799                                 
Symbol
truB
Name
(GenBank) tRNA pseudouridine synthase B
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
lmir  Lautropia mirabilis
Brite
KEGG Orthology (KO) [BR:lmir00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lmir03016]
    NCTC12852_01388 (truB)
Enzymes [BR:lmir01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     NCTC12852_01388 (truB)
Transfer RNA biogenesis [BR:lmir03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    NCTC12852_01388 (truB)
 Prokaryotic type
    NCTC12852_01388 (truB)
SSDB
Motif
Pfam: TruB_N TruB_C_2 TruB-C_2
Other DBs
NCBI-ProteinID: VEH01685
LinkDB
Position
1:1731155..1732096
AA seq 313 aa
MKVHGLLLLDKPLGLSSNTALQKVKRLLGADKAGHGGTLDPMASGVLPLMFGEACKLAGA
ALTHDKAYEAEVCFGITTATDDVEGEVISRSDSRPTREALLAALPRFMGVIQQVPPVYSA
LKVGGKAMYRHAREGAPVAAQPREVRVDVIELLDFDGERARLRIECGSGTYIRSIARDLG
AALGCGAHLSGLRRTRVGQYRVQDAVTLDALLAEGPTAAQSHLHGLLALVAGWSQAELTD
EQARRFAQGQAVPWQTPTNPNADLSSSPAGPAIDAPEGQVAVLHAGRLAGLARQVPQPDG
SVRLAPLRVIVPD
NT seq 942 nt   +upstreamnt  +downstreamnt
ttgaaggtccacggactgctgctgctcgacaagccgctgggcctgtcttccaatacggcc
ttgcagaaggtgaagcgcctgctgggcgcggacaaggctggccatgggggaacactggac
ccgatggccagcggggttctgccgctgatgtttggcgaggcctgcaagctggccggcgcg
gcactcacgcatgacaaggcctacgaggccgaggtctgcttcggcatcaccacggccacc
gatgacgtggaaggcgaggtgatttcccgctcggattcacgccccacgcgtgaggcgctg
ctggcagcgctgccgcgcttcatgggcgtcatccagcaggtaccgccggtgtattcggcc
ctgaaggtgggcggcaaggcgatgtaccgccatgcccgtgagggcgctccggtggcggcc
cagccccgcgaggtgcgggtcgatgtcatcgagctgctggattttgacggtgagcgggcg
cgtctgcgcatcgaatgcggcagcggcacctacatccgttccattgcccgcgacctgggc
gcagccctggggtgcggtgcccatctgagcggtctgaggcgtactcgcgttggccagtac
cgcgtgcaggatgcggtgacgctggatgccttgctggccgaggggccgacggcggcgcag
tctcatctgcatgggctgctggcgctggtggcaggatggtcgcaggctgagctgacggat
gagcaggcccggcgctttgcgcaggggcaggcagtgccctggcagaccccaacgaacccg
aatgccgatctctcgtcgtcgcccgccgggcccgccattgacgccccggaggggcaggtg
gcagtgctgcatgctggccgactggccggactggcccgccaggtgccgcagcctgatggc
agcgtgcgtctggcgccactgcgggtcatcgtgcctgactga

DBGET integrated database retrieval system